TkA04G076910 | RubberDandelionOmics

Gene overview

TkA04G076910

Reference: TK1151 Chr: Chr04 Coordinates: 20268168-20268665 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · TkA04G076910|TK1151|cDNA

ATGAAAGTTTCAAATTCAGTTGCTTACCAATGCTACAACGCATCTGGATACGTAATTGAACAAAGATCAGACCAAGTAGTGGATGAGTTGGAGAACACCCCGTTCACTTTTTCACAGAAGAACAAGTTCGTTGGAATTGGATGCAACAATTTGGCTTATATCATGGGCACGAGTAGAGTCAATTTCATTGGTAGCTGTGTGGGATCATGTAGAAACAAAAGCGAGGTCCATAAAGACGAGTGTTCAGGAATTGGGTGTTG...

CDS

Download CDS FASTA

498 bp · TkA04G076910|TK1151|CDS

ATGAAAGTTTCAAATTCAGTTGCTTACCAATGCTACAACGCATCTGGATACGTAATTGAACAAAGATCAGACCAAGTAGTGGATGAGTTGGAGAACACCCCGTTCACTTTTTCACAGAAGAACAAGTTCGTTGGAATTGGATGCAACAATTTGGCTTATATCATGGGCACGAGTAGAGTCAATTTCATTGGTAGCTGTGTGGGATCATGTAGAAACAAAAGCGAGGTCCATAAAGACGAGTGTTCAGGAATTGGGTGTTG...

Protein

Download Protein FASTA

165 aa · TkA04G076910|TK1151|PROTEIN

MKVSNSVAYQCYNASGYVIEQRSDQVVDELENTPFTFSQKNKFVGIGCNNLAYIMGTSRVNFIGSCVGSCRNKSEVHKDECSGIGCCQTTIPKGLKVYVPIVSFFNDLTPVPSFNPCSFAFLGDEDSFKFRGVRDLSNASEFLNRTNSLVDRCNLCTYFYCVFIN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G076910`
TK1151 ID	TkA04G076910
OH-1004 ID	LXL04_036091
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.000
Protein coverage (%)	TK1151 90.909 / OH-1004 26.596 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G076910`
Location	Chr04:20268168-20268665 (+)
Description	Similar to WAK2: Wall-associated receptor kinase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036091` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007166 cell surface receptor signaling pathway Biological Process GO:0009311 oligosaccharide metabolic process Biological Process GO:0009615 response to virus Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0009992 intracellular water homeostasis Biological Process GO:0048527 lateral root development Biological Process GO:0050832 defense response to fungus Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT1G21210 ath:AT1G21230 ath:AT1G21240 ath:AT1G21250 ath:AT1G21270 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.424

Rank 1 · TkA04G076910 · TK1151

Extracellular0.233

Rank 2 · TkA04G076910 · TK1151

Endoplasmic reticulum0.128

Rank 3 · TkA04G076910 · TK1151

Cytoplasm0.119

Rank 4 · TkA04G076910 · TK1151

Lysosome / Vacuole0.081

Rank 5 · TkA04G076910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08488WAK39-39 aa

PF08488WAK80-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G076910	`PF08488`	WAK	39	39	0.0085	17.3
TkA04G076910	`PF08488`	WAK	80	128	0.0085	17.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card