RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G076030
Reference: TK1151 Chr: Chr04 Coordinates: 20001301-20005311 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2911 bp · TkA04G076030|TK1151|cDNA

GATCGTTGGCTCGATCTTCTTCACTAATTTCTGAGTGACTATAATTTATTTCAGTTTTTTGTTATGTGAATCTATTCATTCTTGTCCATTTCATATTTATTATTGTAAAACGTGGAGCACCTTGTTACTTCAAAGTCCATGGGTGTTTCCGTTGAAACTTGCTAGCTAGCACTCTATAAGACACTGCAATAATTCGTTGCCAAACACATATTTGATCACATATAAAATTGAAAAGTAGAAACATGCTTCTTCTTCTTTTC...

CDS

Download CDS FASTA

2229 bp · TkA04G076030|TK1151|CDS

ATGCTTCTTCTTCTTTTCACCCTCGTTCTATTTACTTCAAGTTTCACCCCAACAGCCATGGGGAAGATAGGAAAGCCAGGATGCCGAACCCAATGCGGGAACTTGACGATCCAATACCCTTTTGGCATAGACAAAGGCTGTTCCATGGACGAATCATTTGATCTAACCTGCAACTTAACTACTACCCCCCCAAAGCTTTTCATCGGATCAGGGAACATCGAAATCTACAATATTTCAGGACCCGAGATGAAAATCTCCAA...

Protein

Download Protein FASTA

742 aa · TkA04G076030|TK1151|PROTEIN

MLLLLFTLVLFTSSFTPTAMGKIGKPGCRTQCGNLTIQYPFGIDKGCSMDESFDLTCNLTTTPPKLFIGSGNIEIYNISGPEMKISNSIGFRCYNESGYATYELIAWTNLETTPFSFSQKNKFTVIGCDDSALITGRNGIDFTSGCLGLCSKASDVPIGYCSGNGCCQTSIPKGLKFYNVSLGSFNNHEKVHSFNPCGFAFLGEEESFTFGGVPDLSDMDLDVKIDNSLRIVVDWVIGGKRNCTQAMECKGNSFCEDEET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G076030
TK1151 IDTkA04G076030
OH-1004 IDLXL04_036098
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G076030
LocationChr04:20001301-20005311 (+)
DescriptionSimilar to WAK2: Wall-associated receptor kinase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g21270 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21230 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21250 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Oxygen-evolving enhancer protein 2 is phosphorylated by glycine-rich protein 3/wall-associated kinase 1 in Arabidopsis.2003 · DOI: 10.1016/s0006-291x(03)00851-9
Aluminum-induced gene expression and protein localization of a cell wall-associated receptor kinase in Arabidopsis.2003 · DOI: 10.1104/pp.103.022129
At1g21240 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21210 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Antisense expression of a cell wall-associated protein kinase, WAK4, inhibits cell elongation and alters morphology.2001 · DOI: 10.1105/tpc.13.6.1317

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036098 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007166 cell surface receptor signaling pathway Biological Process
GO:0009311 oligosaccharide metabolic process Biological Process
GO:0009615 response to virus Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009992 intracellular water homeostasis Biological Process
GO:0048527 lateral root development Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G21210
ath:AT1G21230
ath:AT1G21240
ath:AT1G21250
ath:AT1G21270
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.875
Rank 1 · TkA04G076030 · TK1151
Cytoplasm0.076
Rank 2 · TkA04G076030 · TK1151
Endoplasmic reticulum0.071
Rank 3 · TkA04G076030 · TK1151
Nucleus0.044
Rank 4 · TkA04G076030 · TK1151
Lysosome / Vacuole0.026
Rank 5 · TkA04G076030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947GUB_WAK_bind28-80 aa
PF07645EGF_CA90-100 aa
PF14670FXa_inhibition145-153 aa
PF00008EGF160-168 aa
PF08488WAK161-208 aa
PF12661hEGF161-168 aa
PF07645EGF_CA243-273 aa
PF00008EGF243-274 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G076030PF13947GUB_WAK_bind28802.1e-0938.3
TkA04G076030PF07645EGF_CA901001.2e-0629.3
TkA04G076030PF14670FXa_inhibition1451530.005317.6
TkA04G076030PF00008EGF1601680.0002621.9
TkA04G076030PF08488WAK1612080.009117.3
TkA04G076030PF12661hEGF1611680.8210.9
TkA04G076030PF07645EGF_CA2432731.2e-0629.3
TkA04G076030PF00008EGF2432740.0002621.9
TkA04G076030PF12947EGF_32482742.9e-0731.3
TkA04G076030PF14670FXa_inhibition2492720.005317.6
TkA04G076030PF12661hEGF2492710.8210.9
TkA04G076030PF23427EGF_42512721.29.9
TkA04G076030PF12662cEGF2622863e-0627.7
TkA04G076030PF07645EGF_CA2833241.2e-0629.3
TkA04G076030PF14670FXa_inhibition2893160.005317.6
TkA04G076030PF00008EGF2953170.0002621.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LMP1Arabidopsis thalianasp|Q9LMP1|WAK2_ARATH Wall-associated receptor kinase 244.800%Swiss-ProtMedium
Q9LMN7Arabidopsis thalianasp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 544.500%Swiss-ProtMedium
Q39191Arabidopsis thalianasp|Q39191|WAK1_ARATH Wall-associated receptor kinase 143.100%Swiss-ProtMedium
Q9LMN8Arabidopsis thalianasp|Q9LMN8|WAK3_ARATH Wall-associated receptor kinase 343.500%Swiss-ProtMedium
Q9LMN6Arabidopsis thalianasp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 441.500%Swiss-ProtMedium

JBrowse

View in Genome Browser