TkA04G074790 | RubberDandelionOmics

Gene overview

TkA04G074790

Reference: TK1151 Chr: Chr04 Coordinates: 19719645-19724063 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2908 bp · TkA04G074790|TK1151|cDNA

AAAAAAGTGGTGTGTTTTATATTGCAGCGTATGTAACGGAAAGCTAAAACCTAAAACCCCCAATTCTCCAGACTGTTCTTTTCTCCAACCTTCGACGCATAAACCCCAAATTCTCCAATACCCCACGATCTTGAGGAAAATACGAGCATGATCAATTTTCGTGGCAATATTTGGCGCGTAATAGACCCGCCCAATTTTTATTGGGGTATAAGGGTTAAGAATTCAGTTGATGGTGAGATCATAGACGACAAAGCAGTTAC...

CDS

Download CDS FASTA

1260 bp · TkA04G074790|TK1151|CDS

ATGAGTCAACGACAAAGAAAAAAACGGAGCGTGACAATGATAAGGGAAAACCCTAAAACCAAACCAGAGTTGCAAATTGAGTTTGATGAACTAGGCCAAAACATTGGAGCGACCCAATCCCAGTTCAGCAATTATTGTGGAGTAATGGTAAGGACAAGGATTTCCATACTTAAATTGCGGTGGGATGAAGTGCCTGAACCTGAACTCCATCAACTGTGGTTAAACATTAAGAAACATTGGAATATTGTAGATGAAAAGTA...

Protein

Download Protein FASTA

419 aa · TkA04G074790|TK1151|PROTEIN

MSQRQRKKRSVTMIRENPKTKPELQIEFDELGQNIGATQSQFSNYCGVMVRTRISILKLRWDEVPEPELHQLWLNIKKHWNIVDEKYKKPVLKICNQAWKAYKSRLVKEYLRKGRSPIADYPYLDEPTWNAFVQLKSSKEFQEISSKARETAKLNKYPPRIGPLGYRGMKPRWEKEIDAGDFTEFHNIKSERARNFLLARLKRDSTGVYTLPTDLYTLASDLLEKDTQFDEGDWVPGPGADVLTEVLGPEHPGRTRAVGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G074790`
TK1151 ID	TkA04G074790
OH-1004 ID	LXL04_021942
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.091 / OH-1004 16.226 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G074790`
Location	Chr04:19719645-19724063 (-)
Description	Similar to HSP70-1: Heat shock 70 kDa protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021942` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006457 protein folding Biological Process GO:0006950 response to stress Biological Process GO:0009408 response to heat Biological Process GO:0009615 response to virus Biological Process GO:0009617 response to bacterium Biological Process GO:0010187 negative regulation of seed germination Biological Process GO:0010286 heat acclimation Biological Process GO:0042026 protein refolding Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050832 defense response to fungus Biological Process GO:0090332 stomatal closure Biological Process
KEGG gene cross-reference	ath:AT5G02490 ath:AT5G02500 sly:101247772 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.926

Rank 1 · TkA04G074790 · TK1151

Cytoplasm0.164

Rank 2 · TkA04G074790 · TK1151

Mitochondrion0.029

Rank 3 · TkA04G074790 · TK1151

Cell membrane0.018

Rank 4 · TkA04G074790 · TK1151

Extracellular0.016

Rank 5 · TkA04G074790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13671AAA_3396-140 aa

PF03004Transposase_24126-216 aa

PF05549Allexi_40kDa193-223 aa

PF14591AF0941-like268-324 aa

PF05549Allexi_40kDa272-343 aa

PF03004Transposase_24279-314 aa

PF13671AAA_33289-302 aa

PF02993MCPVI290-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G074790	`PF13671`	AAA_33	96	140	0.2	12.7
TkA04G074790	`PF03004`	Transposase_24	126	216	0.025	15.4
TkA04G074790	`PF05549`	Allexi_40kDa	193	223	0.24	11.6
TkA04G074790	`PF14591`	AF0941-like	268	324	0.005	18.1
TkA04G074790	`PF05549`	Allexi_40kDa	272	343	0.24	11.6
TkA04G074790	`PF03004`	Transposase_24	279	314	0.025	15.4
TkA04G074790	`PF13671`	AAA_33	289	302	0.2	12.7
TkA04G074790	`PF02993`	MCPVI	290	364	0.016	15.8
TkA04G074790	`PF26133`	DUF8039	356	411	4.2e-12	47.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card