Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2937 bp · TkA04G074350|TK1151|cDNA
ATACTTAAAACCCAATCTCAATGAATCCCCACTATAAATACTCCGTATATCTCTTCCTTCTTCACTTCCTCTTTAGTAGGGTTTTGATTTCTCTCTAATGCTCCAATCTGTACCCATATAGATAGATATATAGAGAGAGAAATTGAGAGGTTTATTTAGAGATTTATGCACACAAAGGTAGGAAATGGATGCTTATTCGTTGCATCTAGCCATGGCGGCACTAGTCGGAGCTTCATTTGTTGCTGTTTCGGCTTACTACA...
2514 bp · TkA04G074350|TK1151|CDS
ATGGATGCTTATTCGTTGCATCTAGCCATGGCGGCACTAGTCGGAGCTTCATTTGTTGCTGTTTCGGCTTACTACATGCACCGCAAAACCCTAAATCAATTGCTGGAGTTTGCCAAAACTGTTGAGAAGGAGAGAGATGATGGGGAAGATGAATTGCTGCAGCATTACAGGAAGCGAAATAGTTCCGAGCAGAGGCGGAACCAGGGAGGACGGAGAAATGGATTTTATCGTCAGGGTTCTACATCGTTACCTGAGATCAC...
Protein
Download Protein FASTA837 aa · TkA04G074350|TK1151|PROTEIN
MDAYSLHLAMAALVGASFVAVSAYYMHRKTLNQLLEFAKTVEKERDDGEDELLQHYRKRNSSEQRRNQGGRRNGFYRQGSTSLPEITSISGGSGAHEEDAIPAGLPRLHTLREGKASSHTGLAKRAGHILRPTSPKSPVASASAFESVEGSDEDADINESINLDPTYLHTNGATGAECEGAVENGEQLPIPASSMIRSHSVSGDLHGVQPDPVAADILRKEPEHETFVRLKISPNETPSPDEAEVYRALQVCLEMRNSYV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G074350 |
|---|---|
| TK1151 ID | TkA04G074350 |
| OH-1004 ID | LXL04_036112 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G074350 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:19582283-19586929 (-) | ||||||||||||
| Description | Similar to AMPD: AMP deaminase | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0001708 cell fate specification Biological Process GO:0006188 IMP biosynthetic process Biological Process GO:0009117 nucleotide metabolic process Biological Process GO:0009167 purine ribonucleoside monophosphate metabolic process Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0030435 sporulation resulting in formation of a cellular spore Biological Process GO:0032263 GMP salvage Biological Process GO:0032264 IMP salvage Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0046033 AMP metabolic process Biological Process GO:0046034 ATP metabolic process Biological Process GO:0046039 GTP metabolic process Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT2G38280 ddi:DDB_G0292266 dosa:Os07g0693500 mmu:109674 rno:362015 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF19326AMP_deaminase235-824 aaPF00962A_deaminase652-775 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G074350 | PF19326 | AMP_deaminase | 235 | 824 | 1018.0 | |
| TkA04G074350 | PF00962 | A_deaminase | 652 | 775 | 3.9e-09 | 36.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.