TkA04G073590 | RubberDandelionOmics

Gene overview

TkA04G073590

Reference: TK1151 Chr: Chr04 Coordinates: 19426496-19428775 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2010 bp · TkA04G073590|TK1151|cDNA

CTAATCTCTAAACCTAAACCGGCAGTGAACCGTGAACCCTAAAATTGAATTTCACGAAACACATCCATCCGCCTCCACAGACACACTCCCGTCTCCACTCTCCCGCTCGAGTCTCGACTGCTTCCATCGATTCGACCAGCAGTTCTCCATCCTCCATCCTCCATCGATCACCAGCAGTTCTCCTTCTTCTTCGGCTAATCTTCAGCGCTTCACGACCTCACGAGTCACGACTTCACGAGTCACGACCTCACGTCCTCACC...

CDS

Download CDS FASTA

912 bp · TkA04G073590|TK1151|CDS

ATGGCATTAGTTGTAATTTGCGGTCAACCATGCAGTGGAAAGTCAAAAGCCGCCATTTCCCTCTCAGAAGCCCTAACCAACACCGAATCCAAACCACCCCTCAAAATCATAACCGAAACATCCTTCCATCTAAACCGCAACCAAACCTACGCAGAAATGACCTCAGAAAAAAACCTAAGAGGAGTCCTAAGATCCGAAGTAGACAGACAATTATCAAAAGACACCATCATCATAGTCGATTCCTTAAACAGCATAAAAGG...

Protein

Download Protein FASTA

303 aa · TkA04G073590|TK1151|PROTEIN

MALVVICGQPCSGKSKAAISLSEALTNTESKPPLKIITETSFHLNRNQTYAEMTSEKNLRGVLRSEVDRQLSKDTIIIVDSLNSIKGYRYELWCLARAAGIRHCVLFCDVEETQCRIWNQERIKNNEPSYDDHIFEDLVRRFETPDRRNRWDSPLFELFPFKNEINCNSPVILDLVDYITKRVDSRTKDVKILQPTIATQSVRFSEANSLYEMDKATQEVIGAIVAAQAAAMGGAVVGGVSVGVDLPVVGVSRAVGLPEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G073590`
TK1151 ID	TkA04G073590
OH-1004 ID	LXL04_036121
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 97.030 / OH-1004 59.878 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G073590

Location Chr04:19426496-19428775 (+)

Description Similar to KTI12: Protein KTI12 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13870`	Elongator complex-associated factor that is not a structural subunit but rather transiently contacts the complex.	DRL1, a homolog of the yeast TOT4/KTI12 protein, has a function in meristem activity and organ growth in plants.2003 · DOI: 10.1105/tpc.007062 Transfer RNA modifications and genes for modifying enzymes in Arabidopsis thaliana.2010 · DOI: 10.1186/1471-2229-10-201 Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12.2015 · DOI: 10.14348/molcells.2015.2297

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BK80`	Elongator complex-associated factor that is not a structural subunit but rather transiently contacts the complex (By similarity).	No verified direct reference in this release
`Os11g0312782`	Elongator complex-associated factor that is not a structural subunit but rather transiently contacts the complex.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036121 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002098 tRNA wobble uridine modification Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006400 tRNA modification Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0010449 root meristem growth Biological Process

GO:0048366 leaf development Biological Process

GO:0080178 5-carbamoylmethyl uridine residue modification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0033588 elongator holoenzyme complex Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G13870

dosa:Os11g0312782

dre:751662

xla:735147

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.629

Rank 1 · TkA04G073590 · TK1151

Cytoplasm0.531

Rank 2 · TkA04G073590 · TK1151

Mitochondrion0.046

Rank 3 · TkA04G073590 · TK1151

Peroxisome0.025

Rank 4 · TkA04G073590 · TK1151

Cell membrane0.022

Rank 5 · TkA04G073590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08433KTI121-297 aa

PF13671AAA_333-145 aa

PF01583APS_kinase3-84 aa

PF13238AAA_184-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G073590	`PF08433`	KTI12	1	297	9.5e-76	255.6
TkA04G073590	`PF13671`	AAA_33	3	145	9.9e-12	46.1
TkA04G073590	`PF01583`	APS_kinase	3	84	0.031	15.0
TkA04G073590	`PF13238`	AAA_18	4	88	0.014	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMH0`	Arabidopsis thaliana	sp\|Q9LMH0\|KTI12_ARATH Protein KTI12 homolog	67.100%	Swiss-Prot	High
`B8BK80`	Oryza sativa subsp. indica	sp\|B8BK80\|KTI12_ORYSI Protein KTI12 homolog	66.900%	Swiss-Prot	High
`B9GAG9`	Oryza sativa subsp. japonica	sp\|B9GAG9\|KTI12_ORYSJ Protein KTI12 homolog	66.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card