RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G073080
Reference: TK1151 Chr: Chr04 Coordinates: 19327399-19334713 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4366 bp · TkA04G073080|TK1151|cDNA

CGAAAATAGAAGTGAAAGGGGCACATGGTTCATGTTCGCTTTATATAGTTGGCTTATATATGTGTGCATATATTTACCCCAATCTTTTAAGATTCTTTTGCTTCTTTTGTGCTTACATTCTATTTTTCCACTAAAAATTGAAACTTCATGTCGATTCTGCAAGAACTGGACCACCTTAGAATTCCGCTCGAAGACATAAAACAGGCAACCAACAATTTTGATCGTAGAAATATCATCGGACCGCGTGTTTACTACGGGGT...

CDS

Download CDS FASTA

4236 bp · TkA04G073080|TK1151|CDS

ATGTCGATTCTGCAAGAACTGGACCACCTTAGAATTCCGCTCGAAGACATAAAACAGGCAACCAACAATTTTGATCGTAGAAATATCATCGGACCGCGTGTTTACTACGGGGTGGTGTACGCAGGAGTACTTTTACACTTAAATGGGCCTACTAAGATTGTAGCAAGGCGAATTGATCGGAGTGCAAGTCATGATGAAAAGCATTTTTTAAATGAGATCAGAGTGCTCACTTTATATAAACATGTTAATGTTGTCTCATT...

Protein

Download Protein FASTA

1411 aa · TkA04G073080|TK1151|PROTEIN

MSILQELDHLRIPLEDIKQATNNFDRRNIIGPRVYYGVVYAGVLLHLNGPTKIVARRIDRSASHDEKHFLNEIRVLTLYKHVNVVSFMGFCDEGDEKILVEEFVTCKGLDKFLSNSKLKWLQRLQICLGAARGLNHLHNGVEGHTLIHHSIRSRNIVLDENWQPKIAHLSHSILDQLHHTTDQRIIGKIAYIDPTFLQTGIVTKESDIYSFGVVLFEVLCGRLAYERKEDQIQYLCPLATHHYEDGKLNEIIDPLLRKQM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G073080
TK1151 IDTkA04G073080
OH-1004 IDLXL04_036127
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G073080
LocationChr04:19327399-19334713 (+)
DescriptionSimilar to ANX2: Receptor-like protein kinase ANXUR2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g28680 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release
At5g59700 Probable receptor-like protein kinase At5g59700. No verified direct reference in this release
At5g39000 Putative receptor-like protein kinase At5g39000. No verified direct reference in this release
At2g39360 Probable receptor-like protein kinase At2g39360. No verified direct reference in this release
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036127 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0010183 pollen tube guidance Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0016324 apical plasma membrane Cellular Component
GO:0043680 filiform apparatus Cellular Component
GO:0090404 pollen tube tip Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference
ath:AT5G28680
ath:AT5G59700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.579
Rank 1 · TkA04G073080 · TK1151
Nucleus0.309
Rank 2 · TkA04G073080 · TK1151
Cell membrane0.271
Rank 3 · TkA04G073080 · TK1151
Endoplasmic reticulum0.049
Rank 4 · TkA04G073080 · TK1151
Lysosome / Vacuole0.043
Rank 5 · TkA04G073080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr36-293 aa
PF00069Pkinase52-292 aa
PF16925TetR_C_13117-146 aa
PF01636APH144-162 aa
PF00069Pkinase352-366 aa
PF07714PK_Tyr_Ser-Thr355-660 aa
PF00069Pkinase395-658 aa
PF16925TetR_C_13469-484 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G073080PF07714PK_Tyr_Ser-Thr362931e-103346.9
TkA04G073080PF00069Pkinase522921.1e-83281.4
TkA04G073080PF16925TetR_C_131171460.07414.1
TkA04G073080PF01636APH1441620.02714.9
TkA04G073080PF00069Pkinase3523661.1e-83281.4
TkA04G073080PF07714PK_Tyr_Ser-Thr3556601e-103346.9
TkA04G073080PF00069Pkinase3956581.1e-83281.4
TkA04G073080PF16925TetR_C_134694840.07414.1
TkA04G073080PF01636APH4855290.02714.9
TkA04G073080PF07714PK_Tyr_Ser-Thr6909571e-103346.9
TkA04G073080PF00069Pkinase6959551.1e-83281.4
TkA04G073080PF16925TetR_C_137678080.07414.1
TkA04G073080PF15584Imm72101110470.1912.5
TkA04G073080PF14299PP2103511621.5e-34119.8
TkA04G073080PF14299PP2124714101.5e-34119.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q3E8W4Arabidopsis thalianasp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR240.000%Swiss-ProtLow
Q9FN92Arabidopsis thalianasp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g5970039.100%Swiss-ProtLow
Q9FID8Arabidopsis thalianasp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g3900037.700%Swiss-ProtLow
O80623Arabidopsis thalianasp|O80623|Y2393_ARATH Probable receptor-like protein kinase At2g3936037.400%Swiss-ProtLow
Q9LX66Arabidopsis thalianasp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 138.800%Swiss-ProtLow

JBrowse

View in Genome Browser