TkA04G072980 | RubberDandelionOmics

Gene overview

TkA04G072980

Reference: TK1151 Chr: Chr04 Coordinates: 19312729-19313358 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkA04G072980|TK1151|cDNA

ATGCATCAGTGGCAGTTTCACAATGGGCAACAGATGCTCTTTTGGGGATTAAAAAAGGTGCTCCATTTTTTTCTTTTTCTTACACAAACATATTTCTCTAGAGTGGCATCTGCTTGCAGAAAGAAGGAACATGAATTATCCACGTTAAATGGTGTGATGAAAACAGAATACCCCATTGCTCTAAGGTCTTGTTTAAGAGGTGAATTTGCTGAAGGGGTTAGAGCAGTTTTAGTGGATAAAGATCAGAATCCCAAGTGGAG...

CDS

Download CDS FASTA

339 bp · TkA04G072980|TK1151|CDS

ATGCATCAGTGGCAGTTTCACAATGGGCAACAGATGCTCTTTTGGGGATTAAAAAAGGTGCTCCATTTTTTTCTTTTTCTTACACAAACATATTTCTCTAGAGTGGCATCTGCTTGCAGAAAGAAGGAACATGAATTATCCACGTTAAATGGTGTGATGAAAACAGAATACCCCATTGCTCTAAGGTCTTGTTTAAGAGGTGAATTTGCTGAAGGGGTTAGAGCAGTTTTAGTGGATAAAGATCAGAATCCCAAGTGGAG...

Protein

Download Protein FASTA

112 aa · TkA04G072980|TK1151|PROTEIN

MHQWQFHNGQQMLFWGLKKVLHFFLFLTQTYFSRVASACRKKEHELSTLNGVMKTEYPIALRSCLRGEFAEGVRAVLVDKDQNPKWSPSSLEEVEVSEVEALFEPLASELSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G072980`
TK1151 ID	TkA04G072980
OH-1004 ID	LXL04_002584
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	87.600
Protein coverage (%)	TK1151 86.607 / OH-1004 23.544 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G072980

Location Chr04:19312729-19313358 (-)

Description Similar to At4g13360: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13360`	3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial.	No verified direct reference in this release
`At3g24360`	3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002584 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006574 L-valine catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003860 3-hydroxyisobutyryl-CoA hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G24360

ath:AT4G13360

gga:423979

mmu:227095

rno:301384

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.569

Rank 1 · TkA04G072980 · TK1151

Nucleus0.208

Rank 2 · TkA04G072980 · TK1151

Peroxisome0.174

Rank 3 · TkA04G072980 · TK1151

Mitochondrion0.148

Rank 4 · TkA04G072980 · TK1151

Endoplasmic reticulum0.064

Rank 5 · TkA04G072980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26742DUF824730-96 aa

PF16113ECH_241-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G072980	`PF26742`	DUF8247	30	96	0.083	13.6
TkA04G072980	`PF16113`	ECH_2	41	103	1.3e-16	61.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T0K7`	Arabidopsis thaliana	sp\|Q9T0K7\|HIBC6_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial	70.500%	Swiss-Prot	High
`Q9LK08`	Arabidopsis thaliana	sp\|Q9LK08\|HIBC7_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial	61.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card