TkA04G068550 | RubberDandelionOmics

Gene overview

TkA04G068550

Reference: TK1151 Chr: Chr04 Coordinates: 18172806-18174315 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1085 bp · TkA04G068550|TK1151|cDNA

GAAAAGAAAGAGAAGAGAGGGAGAAAAAAAAGAGGAAAGAGAGAAGATTCTCCGACACCGGTCAACGGCGATTACCTTTCCCGTTTAATGGAGTTCTGCCATTGATCCCCAGAATTACCATATCACTGAGATCGGTTTCAGCAAGAGTCATAAATCACAGACACACTCCAGAAATCTCCCAAAATGGCGGGAATCGTTCAATTGCTCGTATCTGATACAATCATGTCCTTCATGTGGGTATGGTCAAGCGTCATAATCAA...

CDS

Download CDS FASTA

636 bp · TkA04G068550|TK1151|CDS

ATGGCGGGAATCGTTCAATTGCTCGTATCTGATACAATCATGTCCTTCATGTGGGTATGGTCAAGCGTCATAATCAAGCTCTTCGTCCACAATGTTTTGGGGTTTAACCATCACGGCTTCCCTGCTGAAGTCTTTAGGTCTTCGCTTTCCATTCTCAACATGTTCTTCTTTGCTTATCTCGCTAAGCTCACCAATGGCGGTGCCTATAATCCCCTCACTGTCTTGTCCTCCGCCATCTCTGGGAATTTCGCCACCTTCTT...

Protein

Download Protein FASTA

211 aa · TkA04G068550|TK1151|PROTEIN

MAGIVQLLVSDTIMSFMWVWSSVIIKLFVHNVLGFNHHGFPAEVFRSSLSILNMFFFAYLAKLTNGGAYNPLTVLSSAISGNFATFFFTIGLRIPFQVLGAITGALTEGLLTFTIVLISHGLSTKIPGSFFRKTWIASVSKLALHILGSDLTGGCMNPASVMGWAYARGDHITKEHLLVYWVAPIEATLLAAWTFRYLVRTSKEDKEKKTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G068550`
TK1151 ID	TkA04G068550
OH-1004 ID	LXL04_036192
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G068550

Location Chr04:18172806-18174315 (+)

Description Similar to SIP2-1: Probable aquaporin SIP2-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56950`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0320000`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036192 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0015250 water channel activity Molecular Function

GO:0015267 channel activity Molecular Function

KEGG gene cross-reference

ath:AT3G56950

dosa:Os01g0182200

dosa:Os03g0320000

zma:541892

zma:542646

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.670

Rank 1 · TkA04G068550 · TK1151

Cell membrane0.132

Rank 2 · TkA04G068550 · TK1151

Cytoplasm0.106

Rank 3 · TkA04G068550 · TK1151

Golgi apparatus0.089

Rank 4 · TkA04G068550 · TK1151

Nucleus0.087

Rank 5 · TkA04G068550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP8-107 aa

PF00230MIP139-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G068550	`PF00230`	MIP	8	107	9.3e-05	23.0
TkA04G068550	`PF00230`	MIP	139	194	9.3e-05	23.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1K3`	Arabidopsis thaliana	sp\|Q9M1K3\|SIP21_ARATH Probable aquaporin SIP2-1	53.000%	Swiss-Prot	High
`Q10M80`	Oryza sativa subsp. japonica	sp\|Q10M80\|SIP21_ORYSJ Aquaporin SIP2-1	42.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card