TkA04G059050 | RubberDandelionOmics

Gene overview

TkA04G059050

Reference: TK1151 Chr: Chr04 Coordinates: 15748921-15754179 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3628 bp · TkA04G059050|TK1151|cDNA

AACGGCCAAAAGCCAATTATTCAAAATACAGTTGAATCTTTCCCTCTCTTATTTCCATATGGCAATTCATTAAATTTTTTTACATATGGTTTAACGACTGGCTGAGATGTTATACGTTCATAACAATTATAGAAATATATGGGTGAAAACTAAAAATCAGAAGAGAGAGAAGGGGAGAAAAAAGGGGAATGGTTTGAGGGGGAGATGCATAAGAGGAAGGCAGAGCCAAAAATGGAAGATTGGTACATTGCTGTTATTCT...

CDS

Download CDS FASTA

2820 bp · TkA04G059050|TK1151|CDS

ATGACGGTTGTTTCCGGAGTTATATCAAGGCAAGTTGTGCCAGCATGTGGCCATCTTTGCTGCTTTTGCCCTGGACTCCGTACAAGATCCAGGCAGCCTGTCAAGAGGTACAAGAAGCTCATCGCTGACACATTCCCTGTTTATCCGGAGGAAGAACCAAATGATAGGAAGCTTGCAAAACTCTGCGAGTATGCCGTGAGGAATCCTTTACGTATCCCTAAGATCACATCTACCCTTGAGCGACGCTTTTACAAGGAATT...

Protein

Download Protein FASTA

939 aa · TkA04G059050|TK1151|PROTEIN

MTVVSGVISRQVVPACGHLCCFCPGLRTRSRQPVKRYKKLIADTFPVYPEEEPNDRKLAKLCEYAVRNPLRIPKITSTLERRFYKELRNQNFRGARIVMFIYRKLMISCNDQMTLFANSLLSIMHTLLDETRQDEMQIIGCQTLFDFVNSQKDGTYMFTLEKFIPKLCQLAQEVGEDERVEPLRSAGLQALSSMVWFMGRYSYMSPEFDNIVSVVLENYGAPGKESWVKEMLKNDRNTTPANALVKVPSWKAIVNEKGEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G059050`
TK1151 ID	TkA04G059050
OH-1004 ID	LXL04_000374
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.600
Protein coverage (%)	TK1151 99.787 / OH-1004 99.522 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G059050

Location Chr04:15748921-15754179 (+)

Description Similar to SRL2: Protein SEMI-ROLLED LEAF 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0308200`	Functions in regulating leaf rolling through abaxial side leaf cell differentiation.	Semi-Rolled Leaf2 modulates rice leaf rolling by regulating abaxial side cell differentiation.2016 · DOI: 10.1093/jxb/erw029

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000374 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030154 cell differentiation Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

cbr:CBG_02625

cel:CELE_C32D5.3

dosa:Os03g0308200

hsa:23167

osa:4332616

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.530

Rank 1 · TkA04G059050 · TK1151

Nucleus0.305

Rank 2 · TkA04G059050 · TK1151

Cell membrane0.226

Rank 3 · TkA04G059050 · TK1151

Golgi apparatus0.094

Rank 4 · TkA04G059050 · TK1151

Lysosome / Vacuole0.072

Rank 5 · TkA04G059050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21052EFR3_ARM58-731 aa

PF21072EFR370-132 aa

PF27570TOF-1-like_helical84-137 aa

PF28349HSF2BP_C119-195 aa

PF28349HSF2BP_C293-356 aa

PF21072EFR3358-481 aa

PF27570TOF-1-like_helical472-486 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G059050	`PF21052`	EFR3_ARM	58	731	1.6e-80	272.3
TkA04G059050	`PF21072`	EFR3	70	132	0.073	12.6
TkA04G059050	`PF27570`	TOF-1-like_helical	84	137	0.59	11.1
TkA04G059050	`PF28349`	HSF2BP_C	119	195	0.036	15.2
TkA04G059050	`PF28349`	HSF2BP_C	293	356	0.036	15.2
TkA04G059050	`PF21072`	EFR3	358	481	0.073	12.6
TkA04G059050	`PF27570`	TOF-1-like_helical	472	486	0.59	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q10MI0`	Oryza sativa subsp. japonica	sp\|Q10MI0\|SRL2_ORYSJ Protein SEMI-ROLLED LEAF 2	32.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card