TkA04G058430 | RubberDandelionOmics

Gene overview

TkA04G058430

Reference: TK1151 Chr: Chr04 Coordinates: 15578253-15579106 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · TkA04G058430|TK1151|cDNA

ATGGACAACTGCCGGCGAACAACAGCTCCGTTCAAACCATGGAAGAAAGGCCCCACCAGAGGCAAAGGCGGTCCCCAAAACGCCGCCTGTGAGTTCCGCGGCGTCCGCCAAAGAACGTGGGGCAAATGGGTGGCGGAAATCAGAGAACCCAAGAAACGAACCAGGCTATGGTTGGGTTCTTTTGCTACGGCGGAAGAAGCTGCCATGGCTTACGATGAAGCTGCGAGAAGACTCTATGGACCTGATGCGTACCTGAACTT...

CDS

Download CDS FASTA

819 bp · TkA04G058430|TK1151|CDS

ATGGACAACTGCCGGCGAACAACAGCTCCGTTCAAACCATGGAAGAAAGGCCCCACCAGAGGCAAAGGCGGTCCCCAAAACGCCGCCTGTGAGTTCCGCGGCGTCCGCCAAAGAACGTGGGGCAAATGGGTGGCGGAAATCAGAGAACCCAAGAAACGAACCAGGCTATGGTTGGGTTCTTTTGCTACGGCGGAAGAAGCTGCCATGGCTTACGATGAAGCTGCGAGAAGACTCTATGGACCTGATGCGTACCTGAACTT...

Protein

Download Protein FASTA

272 aa · TkA04G058430|TK1151|PROTEIN

MDNCRRTTAPFKPWKKGPTRGKGGPQNAACEFRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAYLNLPHLRSNFNPLNKSHKFKWFSSNKFMSIFPATGLLNLNAQPSVHVIHQRLEELKKTQVSSSSSSSSNSSSVVDQIGHDQVTVTSEKNVTHVKECVIQKPQIDLNEFLQQIGVLKKDDQIMETDQLLSSKAVVVEESDLGEEDFNWDVLSEIHGGHDHYDQINYDVNVHDVHDHD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G058430`
TK1151 ID	TkA04G058430
OH-1004 ID	LXL04_036282
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.600
Protein coverage (%)	TK1151 96.691 / OH-1004 96.491 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G058430

Location Chr04:15578253-15579106 (-)

Description Similar to DREB2F: Dehydration-responsive element-binding protein 2F

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57600`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release
`At1g75490`	Putative transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release
`At5g18450`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release
`At5g05410`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	DNA-binding specificity of the ERF/AP2 domain of Arabidopsis DREBs, transcription factors involved in dehydration- and cold-inducible gene expression.2002 · DOI: 10.1006/bbrc.2001.6299 Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits.2014 · DOI: 10.1105/tpc.114.132928

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0174400`	Probable transcriptional activator that binds to the DNA sequence 5'-[AG]CCGAC-3' of the cis-acting dehydration-responsive element (DRE).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036282 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006950 response to stress Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G75490

ath:AT3G57600

ath:AT5G18450

dosa:Os03g0174400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · TkA04G058430 · TK1151

Cytoplasm0.104

Rank 2 · TkA04G058430 · TK1151

Cell membrane0.026

Rank 3 · TkA04G058430 · TK1151

Endoplasmic reticulum0.019

Rank 4 · TkA04G058430 · TK1151

Plastid0.014

Rank 5 · TkA04G058430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP232-80 aa

PF00847AP299-111 aa

PF11493TSP9148-155 aa

PF11493TSP9196-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G058430	`PF00847`	AP2	32	80	2.1e-14	54.2
TkA04G058430	`PF00847`	AP2	99	111	2.1e-14	54.2
TkA04G058430	`PF11493`	TSP9	148	155	0.42	12.0
TkA04G058430	`PF11493`	TSP9	196	213	0.42	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVX5`	Arabidopsis thaliana	sp\|Q9SVX5\|DRE2F_ARATH Dehydration-responsive element-binding protein 2F	55.200%	Swiss-Prot	High
`Q9LQZ2`	Arabidopsis thaliana	sp\|Q9LQZ2\|DRE2D_ARATH Dehydration-responsive element-binding protein 2D	70.900%	Swiss-Prot	Low
`P61827`	Arabidopsis thaliana	sp\|P61827\|DRE2G_ARATH Dehydration-responsive element-binding protein 2G	73.300%	Swiss-Prot	Low
`O82132`	Arabidopsis thaliana	sp\|O82132\|DRE2A_ARATH Dehydration-responsive element-binding protein 2A	62.800%	Swiss-Prot	Low
`Q10R18`	Oryza sativa subsp. japonica	sp\|Q10R18\|DRE2E_ORYSJ Dehydration-responsive element-binding protein 2E	47.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card