TkA04G057090 | RubberDandelionOmics

Gene overview

TkA04G057090

Reference: TK1151 Chr: Chr04 Coordinates: 15237142-15238411 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1148 bp · TkA04G057090|TK1151|cDNA

GCACATTCACCCCCATCTCGCTCCTCCTTTCTCCCAACTGCTTTTCGATCAAAACTCAAAACAAACAAAGAATCGCCATGCCGATACTCCGATCTCCTTGACAAACCCTAATCCTGAAACACATTCCCAACATCAAATTCCCCACATTCCCTGAAATAATTTCCTCACATTGTCTCGCCGCTATCATCTCTGCGTCTTAAAATCAGCAAATCTTTTGGATCACAGTCCAAAAGATTTCCACATGATTTATTAAACAAAAA...

CDS

Download CDS FASTA

654 bp · TkA04G057090|TK1151|CDS

ATGTCGAATAATAATTTCGGAGATAAGGCCGATTACGTATTCAAAGTAGTATTGATCGGAGACTCAGCTGTCGGAAAATCTCAGCTCCTCGCGCGTTTCGCCAAGAATGAATTCAGTAACGATTCAAAATCCACGATTGGGGTTGAATTCCAGACGAAATCCTTGATAATTGATCAGAAGACGGTGAAGGCGCAGATTTGGGATACTGCTGGTCAAGAAAGATACAGAGCAGTGACAAGTGCGTATTATCGAGGAGCACT...

Protein

Download Protein FASTA

217 aa · TkA04G057090|TK1151|PROTEIN

MSNNNFGDKADYVFKVVLIGDSAVGKSQLLARFAKNEFSNDSKSTIGVEFQTKSLIIDQKTVKAQIWDTAGQERYRAVTSAYYRGALGAMLVYDMTKRQTFDHMTRWLEELRGHADKNIVIMLIGNKCDLTDYRAVPIEDAKEFAEREKLYFMETSALEAINVEKAFLEALTEIYRTVSKKSLNADDDNEKSASLKGTAIIVPNQEANSGAKSGCCA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G057090`
TK1151 ID	TkA04G057090
OH-1004 ID	LXL04_036300
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G057090

Location Chr04:15237142-15238411 (-)

Description Similar to RABA4D: Ras-related protein RABA4d

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12160`	Intracellular vesicle trafficking and protein transport.	The Rab GTPase RabA4d regulates pollen tube tip growth in Arabidopsis thaliana.2009 · DOI: 10.1105/tpc.108.060277
`At5g47960`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0281700`	May play an important role in plant growth and development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036300 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0015031 protein transport Biological Process

GO:0048868 pollen tube development Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0045177 apical part of cell Cellular Component

GO:0070382 exocytic vesicle Cellular Component

KEGG gene cross-reference

ath:AT3G12160

ath:AT5G47960

nta:107766135

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.453

Rank 1 · TkA04G057090 · TK1151

Golgi apparatus0.420

Rank 2 · TkA04G057090 · TK1151

Cell membrane0.244

Rank 3 · TkA04G057090 · TK1151

Lysosome / Vacuole0.152

Rank 4 · TkA04G057090 · TK1151

Endoplasmic reticulum0.150

Rank 5 · TkA04G057090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf14-149 aa

PF00071Ras15-175 aa

PF08477Roc15-129 aa

PF01926MMR_HSR115-122 aa

PF05621TniB15-41 aa

PF04670Gtr1_RagA15-131 aa

PF00493MCM15-36 aa

PF13191AAA_1616-36 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G057090	`PF00025`	Arf	14	149	8.8e-14	52.1
TkA04G057090	`PF00071`	Ras	15	175	4.8e-63	212.3
TkA04G057090	`PF08477`	Roc	15	129	1.3e-35	123.0
TkA04G057090	`PF01926`	MMR_HSR1	15	122	9.3e-06	26.5
TkA04G057090	`PF05621`	TniB	15	41	0.037	14.2
TkA04G057090	`PF04670`	Gtr1_RagA	15	131	0.068	13.3
TkA04G057090	`PF00493`	MCM	15	36	0.1	12.4
TkA04G057090	`PF13191`	AAA_16	16	36	0.076	14.2
TkA04G057090	`PF03193`	RsgA_GTPase	16	36	0.083	13.4
TkA04G057090	`PF13401`	AAA_22	16	113	0.16	13.0
TkA04G057090	`PF00009`	GTP_EFTU	47	174	4e-06	27.3
TkA04G057090	`PF03193`	RsgA_GTPase	115	164	0.083	13.4
TkA04G057090	`PF06569`	DUF1128	147	182	0.15	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LH50`	Arabidopsis thaliana	sp\|Q9LH50\|RAA4D_ARATH Ras-related protein RABA4d	76.800%	Swiss-Prot	High
`Q9FE79`	Arabidopsis thaliana	sp\|Q9FE79\|RAA4C_ARATH Ras-related protein RABA4c	73.100%	Swiss-Prot	High
`P25766`	Oryza sativa subsp. japonica	sp\|P25766\|RLGP1_ORYSJ Ras-related protein RGP1	73.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card