TkA04G055070 | RubberDandelionOmics

Gene overview

TkA04G055070

Reference: TK1151 Chr: Chr04 Coordinates: 14701253-14704746 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1704 bp · TkA04G055070|TK1151|cDNA

TTAAAGCTGAATGTCAGAAGGAAGTACAAAGGGGCTAAAATTGTAATTTTGGCTTTTAAGTAGATACCCACCTTTTTTTTTTCTGTTGATACTCCCAAAGAGGGAATGGAAACAAAGCGAGAAGAAAAAAGGTTTGTTTAGAACAGAAAACAGTAACCAGAAAAGGAGCATTAATATTCACCAATTTTTCAGGGTACAAAACATTTAGCACAAAGTACAACTATTAACCTTGCTTCACCCTAAACCGCAAGAAAAATCCA...

CDS

Download CDS FASTA

1056 bp · TkA04G055070|TK1151|CDS

ATGGAGATGGGCGGTGGTTCTAGCGGTTCTTCCGAGTCGCAACTGCTCAAAATCGGTCTGCAATTCGGGAAAGAAATCTACTTTGAGGATGTGGGTGTCGGAGCCCAGGCCAAATCCGAAGGTGGATTGTCTGCGGCGAGCGGCGGCGGTGATGCTGGAGGACCACAGAAGAAAGGTCGGACTGCTGGCGGTGGTGCGGTGGCGGGGGTTTTGGTACAGGGTCAGCAACCGCCGAGGTGCCAGGTGGAAGGGTGTAATCT...

Protein

Download Protein FASTA

351 aa · TkA04G055070|TK1151|PROTEIN

MEMGGGSSGSSESQLLKIGLQFGKEIYFEDVGVGAQAKSEGGLSAASGGGDAGGPQKKGRTAGGGAVAGVLVQGQQPPRCQVEGCNLDLSDAKTYYSRHKVCGAHSKTAKVIVNGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKPSLLSTRYGTVASSIFENNGNSGGFLMDFSSCSRGRVQWPGGTRAAPLPRTAIDLPVSGEKFPPLPWQSHLDNPPPYVPPGGCYDGVQEDSNCALSLLSNHSSASRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G055070`
TK1151 ID	TkA04G055070
OH-1004 ID	LXL04_036322
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G055070

Location Chr04:14701253-14704746 (+)

Description Similar to SPL3: Squamosa promoter-binding-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42200`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release
`At3g57920`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0491532`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity).	No verified direct reference in this release
`Os08g0509600`	Transcriptional activator that binds to the SBP-box DNA core binding motif 5'-GTAC-3'.	OsSPL14 promotes panicle branching and higher grain productivity in rice.2010 · DOI: 10.1038/ng.592 Regulation of OsSPL14 by OsmiR156 defines ideal plant architecture in rice.2010 · DOI: 10.1038/ng.591 Control of tiller growth of rice by OsSPL14 and Strigolactones, which work in two independent pathways.2012 · DOI: 10.1093/pcp/pcs122 Genome-wide binding analysis of the transcription activator ideal plant architecture1 reveals a complex network regulating rice plant architecture.2013 · DOI: 10.1105/tpc.113.113639 Enhanced expression of OsSPL14 gene and its association with yield components in rice (Oryza sativa) under low nitrogen conditions.2016 · DOI: 10.1016/j.gene.2015.10.062 IPA1 functions as a downstream transcription factor repressed by D53 in strigolactone signaling in rice.2017 · DOI: 10.1038/cr.2017.102 A single transcription factor promotes both yield and immunity in rice.2018 · DOI: 10.1126/science.aat7675 Inducible overexpression of Ideal Plant Architecture1 improves both yield and disease resistance in rice.2019 · DOI: 10.1038/s41477-019-0383-2

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036322 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0048653 anther development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G57920

dosa:Os06g0703500

osa:4341986

osa:9270639

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.901

Rank 1 · TkA04G055070 · TK1151

Cytoplasm0.204

Rank 2 · TkA04G055070 · TK1151

Cell membrane0.032

Rank 3 · TkA04G055070 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA04G055070 · TK1151

Mitochondrion0.017

Rank 5 · TkA04G055070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03110SBP80-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G055070	`PF03110`	SBP	80	153	7.2e-33	113.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q700W2`	Arabidopsis thaliana	sp\|Q700W2\|SPL9_ARATH Squamosa promoter-binding-like protein 9	45.600%	Swiss-Prot	Medium
`Q9M2Q6`	Arabidopsis thaliana	sp\|Q9M2Q6\|SPL15_ARATH Squamosa promoter-binding-like protein 15	41.400%	Swiss-Prot	Medium
`A3C057`	Oryza sativa subsp. japonica	sp\|A3C057\|SPL17_ORYSJ Squamosa promoter-binding-like protein 17	51.200%	Swiss-Prot	Medium
`Q7EXZ2`	Oryza sativa subsp. japonica	sp\|Q7EXZ2\|SPL14_ORYSJ Squamosa promoter-binding-like protein 14	51.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card