TkA04G054730 | RubberDandelionOmics

Gene overview

TkA04G054730

Reference: TK1151 Chr: Chr04 Coordinates: 14626041-14626562 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · TkA04G054730|TK1151|cDNA

ATGATGGAATTAGCAAAGGGGCTTGAAGAGACCGAGAAGCCCTTTATATGGGTGATTAGGCCACCATTCGGGTTTGATCTTAAAGAGCAGTTTCGACCCGAATGGTTGCCTTTGGGTTTTGAGGATAGAATTAGAAACCAAGGGTTGTTGGTGCACAAGTGGGCGCCTCAGTTGGAAATACTAAGCCACCCATCAACCGGAGCTTTCTTGAGCCATTGTGGGTGGAACTCGGTGATGGAGAGTCTAAGCCAAGGGGTTCC...

CDS

Download CDS FASTA

522 bp · TkA04G054730|TK1151|CDS

ATGATGGAATTAGCAAAGGGGCTTGAAGAGACCGAGAAGCCCTTTATATGGGTGATTAGGCCACCATTCGGGTTTGATCTTAAAGAGCAGTTTCGACCCGAATGGTTGCCTTTGGGTTTTGAGGATAGAATTAGAAACCAAGGGTTGTTGGTGCACAAGTGGGCGCCTCAGTTGGAAATACTAAGCCACCCATCAACCGGAGCTTTCTTGAGCCATTGTGGGTGGAACTCGGTGATGGAGAGTCTAAGCCAAGGGGTTCC...

Protein

Download Protein FASTA

173 aa · TkA04G054730|TK1151|PROTEIN

MMELAKGLEETEKPFIWVIRPPFGFDLKEQFRPEWLPLGFEDRIRNQGLLVHKWAPQLEILSHPSTGAFLSHCGWNSVMESLSQGVPMIGWPLGAEQGFNAKMLVEEMGVCVVLTTGVERTITKEDVKKVIEVVFDRNDMREKATELRSLILASVEDSSYKAMDDFVSTFSSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G054730`
TK1151 ID	TkA04G054730
OH-1004 ID	LXL04_036327
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 35.524 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G054730

Location Chr04:14626041-14626562 (+)

Description Similar to UGT92A1: UDP-glycosyltransferase 92A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g12890`	UDP-glycosyltransferase 92A1.	No verified direct reference in this release
`At1g01390`	UDP-glycosyltransferase 72B2.	No verified direct reference in this release
`At4g34131`	Possesses quercetin 3-O-glucosyltransferase activity in vitro.	Pathogen-responsive expression of glycosyltransferase genes UGT73B3 and UGT73B5 is necessary for resistance to Pseudomonas syringae pv tomato in Arabidopsis.2005 · DOI: 10.1104/pp.105.067223

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036327 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0051555 flavonol biosynthetic process Biological Process

GO:0051707 response to other organism Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0009507 chloroplast Cellular Component

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0047893 flavonol 3-O-glucosyltransferase activity Molecular Function

GO:0050275 scopoletin glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G34131

ath:AT5G12890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.421

Rank 1 · TkA04G054730 · TK1151

Cytoplasm0.310

Rank 2 · TkA04G054730 · TK1151

Plastid0.093

Rank 3 · TkA04G054730 · TK1151

Endoplasmic reticulum0.091

Rank 4 · TkA04G054730 · TK1151

Nucleus0.084

Rank 5 · TkA04G054730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT2-150 aa

PF04873EIN3_DNA-bd25-56 aa

PF06722EryCIII-like_C64-153 aa

PF04873EIN3_DNA-bd68-107 aa

PF04101Glyco_tran_28_C70-136 aa

PF21871Gp6_C-III127-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G054730	`PF00201`	UDPGT	2	150	6.9e-24	85.2
TkA04G054730	`PF04873`	EIN3_DNA-bd	25	56	0.05	14.2
TkA04G054730	`PF06722`	EryCIII-like_C	64	153	2.7e-05	24.9
TkA04G054730	`PF04873`	EIN3_DNA-bd	68	107	0.05	14.2
TkA04G054730	`PF04101`	Glyco_tran_28_C	70	136	0.00014	22.6
TkA04G054730	`PF21871`	Gp6_C-III	127	171	0.12	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXV0`	Arabidopsis thaliana	sp\|Q9LXV0\|U92A1_ARATH UDP-glycosyltransferase 92A1	47.000%	Swiss-Prot	Medium
`Q8W4C2`	Arabidopsis thaliana	sp\|Q8W4C2\|U72B2_ARATH UDP-glycosyltransferase 72B2	45.400%	Swiss-Prot	Medium
`Q8W491`	Arabidopsis thaliana	sp\|Q8W491\|U73B3_ARATH UDP-glycosyltransferase 73B3	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card