TkA04G052930 | RubberDandelionOmics

Gene overview

TkA04G052930

Reference: TK1151 Chr: Chr04 Coordinates: 14198468-14200942 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2148 bp · TkA04G052930|TK1151|cDNA

ATGGAGGACGACCGCCGTGTCGGAGATCTAGTCGGGGAATTAGTCCGCCACTTGCAAAGAGATTCTTCCTCTCCACACTCTCACTCAAACCCTAATCCTAACTCCGATGATGTCAAGTACGCCATTCGCATTCTATCCAGCCGGATGACGCCATTGATAGTGCCTAATGAAGCCGCCATGGCTAACTCCATCAAGAGTCACATGGCTAAACAAGGTAAATTATCTGATGCCCTAACTTTTGCAGATCTATATACTAGACT...

CDS

Download CDS FASTA

2148 bp · TkA04G052930|TK1151|CDS

ATGGAGGACGACCGCCGTGTCGGAGATCTAGTCGGGGAATTAGTCCGCCACTTGCAAAGAGATTCTTCCTCTCCACACTCTCACTCAAACCCTAATCCTAACTCCGATGATGTCAAGTACGCCATTCGCATTCTATCCAGCCGGATGACGCCATTGATAGTGCCTAATGAAGCCGCCATGGCTAACTCCATCAAGAGTCACATGGCTAAACAAGGTAAATTATCTGATGCCCTAACTTTTGCAGATCTATATACTAGACT...

Protein

Download Protein FASTA

715 aa · TkA04G052930|TK1151|PROTEIN

MEDDRRVGDLVGELVRHLQRDSSSPHSHSNPNPNSDDVKYAIRILSSRMTPLIVPNEAAMANSIKSHMAKQGKLSDALTFADLYTRLASKTGPGSVKNKHTVLYLLKVISEDRSWNDNLRALRDQNSKKLKNGGVLSIFRDPDDTREMAYREFATLVNMESDVSEEDLVSDVLSVCQGIDGKYVKFDVSIDGYILPDSIKAPKATRIMIRRLCELGWLYQKVIGYICENIDTEKAGKVTKSFCSALQDELLGYDKLLTVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G052930`
TK1151 ID	TkA04G052930
OH-1004 ID	LXL04_000439
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	51.400
Protein coverage (%)	TK1151 100.000 / OH-1004 99.655 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G052930

Location Chr04:14198468-14200942 (+)

Description Similar to GCP3: Gamma-tubulin complex component 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06680`	Gamma-tubulin complex is necessary for microtubule nucleation at the microtubule organizing centers (MTOCs).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000439 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0007020 microtubule nucleation Biological Process

GO:0007338 single fertilization Biological Process

GO:0009624 response to nematode Biological Process

GO:0031122 cytoplasmic microtubule organization Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0090063 positive regulation of microtubule nucleation Biological Process

GO:0000922 spindle pole Cellular Component

GO:0000930 gamma-tubulin complex Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G06680

hsa:10426

mmu:259279

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.429

Rank 1 · TkA04G052930 · TK1151

Cytoplasm0.416

Rank 2 · TkA04G052930 · TK1151

Golgi apparatus0.141

Rank 3 · TkA04G052930 · TK1151

Lysosome / Vacuole0.075

Rank 4 · TkA04G052930 · TK1151

Endoplasmic reticulum0.065

Rank 5 · TkA04G052930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17681GCP_N_terminal169-390 aa

PF04130GCP_C_terminal383-714 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G052930	`PF17681`	GCP_N_terminal	169	390	5.5e-56	191.0
TkA04G052930	`PF04130`	GCP_C_terminal	383	714	7.7e-66	223.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG37`	Arabidopsis thaliana	sp\|Q9FG37\|GACP3_ARATH Gamma-tubulin complex component 3	47.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card