TkA04G050790 | RubberDandelionOmics

Gene overview

TkA04G050790

Reference: TK1151 Chr: Chr04 Coordinates: 13603198-13604941 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1672 bp · TkA04G050790|TK1151|cDNA

TAGAAAACGGTTAAATATATTTGTAATTTTAGTCATTGTCTCTATATAATTGGAAGGGATTAGAGACTAATTAGTATAGAACCGAAAGAACAATGGGAGGTGAGAGAAAGAGATCAAGCAAACCATTGGTACTGGTAGCAAGTCCATTTCAAGGTCACATGACGCCTATGCTTCAGCTAGGCAGTGTCCTCCATTCCAATGGCTTCTCCATAACCTTCGCTCATACTAAATTAAACTCCCCTGATCCTTCAAATCACCCC...

CDS

Download CDS FASTA

1347 bp · TkA04G050790|TK1151|CDS

ATGGGAGGTGAGAGAAAGAGATCAAGCAAACCATTGGTACTGGTAGCAAGTCCATTTCAAGGTCACATGACGCCTATGCTTCAGCTAGGCAGTGTCCTCCATTCCAATGGCTTCTCCATAACCTTCGCTCATACTAAATTAAACTCCCCTGATCCTTCAAATCACCCCGAATTCCTCTTCCTTCCTCTTTCCGATAACTTTTCCGCCATTGATGCCTCTGCTAACTACACCAAGTTCCTCGAAGCTCTCAACAACAACTG...

Protein

Download Protein FASTA

448 aa · TkA04G050790|TK1151|PROTEIN

MGGERKRSSKPLVLVASPFQGHMTPMLQLGSVLHSNGFSITFAHTKLNSPDPSNHPEFLFLPLSDNFSAIDASANYTKFLEALNNNCKTQLQDHLSRKIKDEMNHTITVIHDNIMYFAEEVASNLNLPSIVLRSCSASYMPAFLSLSYLHAKSQLPVRDSMMEELVPDLHPLRYKDLPFHSTPTEVATEMLALAERIRTPSAIIWNTVDFLENSALTQLQEHYKIPIFSIGPLNQMARCPSTSFLKEDTGCISWLDKQAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G050790`
TK1151 ID	TkA04G050790
OH-1004 ID	LXL04_036386
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G050790

Location Chr04:13603198-13604941 (-)

Description Similar to UGT76A2: UDP-glucose iridoid glucosyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46670`	Possesses low quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro.	No verified direct reference in this release
`At3g46660`	Possesses quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036386 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002239 response to oomycetes Biological Process

GO:0006952 defense response Biological Process

GO:0010150 leaf senescence Biological Process

GO:1900994 (-)-secologanin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0010294 abscisic acid glucosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0046527 glucosyltransferase activity Molecular Function

GO:0052640 salicylic acid glucosyltransferase (glucoside-forming) activity Molecular Function

KEGG gene cross-reference

ath:AT3G11340

ath:AT3G46670

sly:101246393

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.784

Rank 1 · TkA04G050790 · TK1151

Nucleus0.248

Rank 2 · TkA04G050790 · TK1151

Plastid0.066

Rank 3 · TkA04G050790 · TK1151

Peroxisome0.062

Rank 4 · TkA04G050790 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA04G050790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N12-46 aa

PF00201UDPGT72-143 aa

PF26168Glyco_transf_N89-235 aa

PF00201UDPGT260-406 aa

PF06722EryCIII-like_C327-407 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G050790	`PF26168`	Glyco_transf_N	12	46	6.5e-07	30.2
TkA04G050790	`PF00201`	UDPGT	72	143	5.5e-27	95.5
TkA04G050790	`PF26168`	Glyco_transf_N	89	235	6.5e-07	30.2
TkA04G050790	`PF00201`	UDPGT	260	406	5.5e-27	95.5
TkA04G050790	`PF06722`	EryCIII-like_C	327	407	0.038	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SNB1`	Arabidopsis thaliana	sp\|Q9SNB1\|U7E11_ARATH UDP-glycosyltransferase 76E11	47.600%	Swiss-Prot	Medium
`Q94AB5`	Arabidopsis thaliana	sp\|Q94AB5\|U7E12_ARATH Flavonol 3-O-glucosyltransferase UGT76E12	47.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card