RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G048470
Reference: TK1151 Chr: Chr04 Coordinates: 12990412-12998379 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1840 bp · TkA04G048470|TK1151|cDNA

TTTCCCTTTCATTTCCAGCCACATATCCTCAAAATAGAACACTACCATATCAATTCGCCAGGTCGTCATCATATATATTTGAAGATACTCAGTTCATTAATTGCAGTTGAAGAAGACCATGTCGTATTATGTCCGCCTTCTTGTTCTTTCTCTTTTTCTTATGATCAGAAACTATGACAATAAACTATGACAATGTATACGGTGTGGTTGATGAATATCGAAGAGATGATTTCCCTGCTGAATTCGTTTTTGGTTCCGCA...

CDS

Download CDS FASTA

1698 bp · TkA04G048470|TK1151|CDS

ATGTCGTATTATGTCCGCCTTCTTGTTCTTTCTCTTTTTCTTATGATCAGAAACTATGACAATGTATACGGTGTGGTTGATGAATATCGAAGAGATGATTTCCCTGCTGAATTCGTTTTTGGTTCCGCAACCTCAGCTTATCAGTTGAAGAAGACCATGTCGTATTATGTCCGCCTTCTTGTTCTTTCTCTTTTTCTTATGATCAGAAACTATGACAATGTATACGGTGTGGTTGATGAATATCGAAGAGATGATTTCCC...

Protein

Download Protein FASTA

565 aa · TkA04G048470|TK1151|PROTEIN

MSYYVRLLVLSLFLMIRNYDNVYGVVDEYRRDDFPAEFVFGSATSAYQLKKTMSYYVRLLVLSLFLMIRNYDNVYGVVDEYRRDDFPAEFVFGSATSAYQVEGAVVEDGRSFSIWDTFAHLGGPWYNGADGDIACDGYHKYKDDIQLMADIGLEAFRFSISWSRLIPNGRGTVNVKGLQFYNDFINNLIAHGIEPHVTLHHHDLPQILEDEYGGWLSRKSVKDFVAYADVCFREFGDRVLHWTTINEGNVFSLGGYDFGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G048470
TK1151 IDTkA04G048470
OH-1004 IDLXL04_037063
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)70.400
Protein coverage (%)TK1151 98.230 / OH-1004 55.739
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G048470
LocationChr04:12990412-12998379 (+)
DescriptionSimilar to LCT: Lactase-phlorizin hydrolase
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g02850 Beta-glucosidase 11. No verified direct reference in this release
At4g22100 Beta-glucosidase 3. No verified direct reference in this release
At1g45191 Beta-glucosidase 1. No verified direct reference in this release
At1g60270 Putative beta-glucosidase 6. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0366600 Beta-glucosidase 22. No verified direct reference in this release
Os05g0366000 Beta-glucosidase 21. No verified direct reference in this release
Os05g0365700 Beta-glucosidase 20. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037063 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0001666 response to hypoxia Biological Process
GO:0005990 lactose catabolic process Biological Process
GO:0007584 response to nutrient Biological Process
GO:0009410 response to xenobiotic stimulus Biological Process
GO:0009725 response to hormone Biological Process
GO:0009744 response to sucrose Biological Process
GO:0010040 response to iron(II) ion Biological Process
GO:0010045 response to nickel cation Biological Process
GO:0010288 response to lead ion Biological Process
GO:0042594 response to starvation Biological Process
GO:0043627 response to estrogen Biological Process
GO:0045471 response to ethanol Biological Process
KEGG gene cross-reference
hsa:3938
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.498
Rank 1 · TkA04G048470 · TK1151
Endoplasmic reticulum0.186
Rank 2 · TkA04G048470 · TK1151
Cell membrane0.127
Rank 3 · TkA04G048470 · TK1151
Cytoplasm0.095
Rank 4 · TkA04G048470 · TK1151
Extracellular0.067
Rank 5 · TkA04G048470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12645HTH_163-32 aa
PF07127Nodulin_late3-20 aa
PF16069DUF48117-27 aa
PF00232Glyco_hydro_132-49 aa
PF07127Nodulin_late54-72 aa
PF12645HTH_1655-84 aa
PF16069DUF481157-79 aa
PF00232Glyco_hydro_184-546 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G048470PF12645HTH_163320.03215.0
TkA04G048470PF07127Nodulin_late3200.4811.5
TkA04G048470PF16069DUF48117270.2611.8
TkA04G048470PF00232Glyco_hydro_132498.2e-148493.4
TkA04G048470PF07127Nodulin_late54720.4811.5
TkA04G048470PF12645HTH_1655840.03215.0
TkA04G048470PF16069DUF481157790.2611.8
TkA04G048470PF00232Glyco_hydro_1845468.2e-148493.4
TkA04G048470PF00150Cellulase1402160.0006520.0
TkA04G048470PF12645HTH_161781880.03215.0
TkA04G048470PF12645HTH_164444570.03215.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
B3H5Q1Arabidopsis thalianasp|B3H5Q1|BGL11_ARATH Beta-glucosidase 1157.300%Swiss-ProtHigh
O65458Arabidopsis thalianasp|O65458|BGL03_ARATH Beta-glucosidase 354.900%Swiss-ProtHigh
Q3ECW8Arabidopsis thalianasp|Q3ECW8|BGL01_ARATH Beta-glucosidase 155.200%Swiss-ProtHigh
Q682B4Arabidopsis thalianasp|Q682B4|BGL06_ARATH Putative beta-glucosidase 666.200%Swiss-ProtHigh
Q60DX8Oryza sativa subsp. japonicasp|Q60DX8|BGL22_ORYSJ Beta-glucosidase 2256.000%Swiss-ProtHigh
Q60DY1Oryza sativa subsp. japonicasp|Q60DY1|BGL21_ORYSJ Beta-glucosidase 2157.200%Swiss-ProtHigh
B9FHH2Oryza sativa subsp. japonicasp|B9FHH2|BGL20_ORYSJ Beta-glucosidase 2058.100%Swiss-ProtHigh

JBrowse

View in Genome Browser