TkA04G048460 | RubberDandelionOmics

Gene overview

TkA04G048460

Reference: TK1151 Chr: Chr04 Coordinates: 12984735-12988404 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1897 bp · TkA04G048460|TK1151|cDNA

AATTCGTTTTCTCTTTGCATTTTCAGCCATATATTTCTCCAAAACAAATCTAGTGGTGTTAATTTGCCTGTCTTGGCTCACTGATGATAGTCGGCAAATTCATCAGTTCTGTACAGAACACAATTAATGTCTAATTCTGTACTTCTTGTTCTTTCTTTTCTTCTCGTGATCCGAAACTATGATAAAGAACAATTCTTATTCGTAAATGGAGTCGTTGATGAATATCAAAGAAACGATTTTCCCAGTGAATTCGTTTTTGG...

CDS

Download CDS FASTA

1566 bp · TkA04G048460|TK1151|CDS

ATGTCTAATTCTGTACTTCTTGTTCTTTCTTTTCTTCTCGTGATCCGAAACTATGATAAAGAACAATTCTTATTCGTAAATGGAGTCGTTGATGAATATCAAAGAAACGATTTTCCCAGTGAATTCGTTTTTGGTTCGGGAACTTCGGCTTATCAGGTTGAAGGAGCTGTGCTGGAAGATGGAAGGAGTTTCAGCATTTGGGACACCTTCGCTCATTCAGGAAACCCCTGGTACAATGGAGCAAATGGAGACATAGCAGT...

Protein

Download Protein FASTA

521 aa · TkA04G048460|TK1151|PROTEIN

MSNSVLLVLSFLLVIRNYDKEQFLFVNGVVDEYQRNDFPSEFVFGSGTSAYQVEGAVLEDGRSFSIWDTFAHSGNPWYNGANGDIAVDGYHKYKKDIQLIADTGLEAYRFSISWSTLIPNGRGSINVKGLQYYNDFINRLISHGIEPHVTLHHFDLPQILEDEYGGWLSRKSVKDFVAYADVCFREFGDRVLHWTTINEANIFSLGGYDYGFAPPGHCSSPFGFYNCSKGDSTSEPYLVAHHLLLAHASTVKLYRRKYKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G048460`
TK1151 ID	TkA04G048460
OH-1004 ID	LXL04_037063
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.800
Protein coverage (%)	TK1151 98.464 / OH-1004 49.416 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G048460

Location Chr04:12984735-12988404 (-)

Description Similar to LCT: Lactase-phlorizin hydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02850`	Beta-glucosidase 11.	No verified direct reference in this release
`At4g27830`	Beta-glucosidase 10.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0366600`	Beta-glucosidase 22.	No verified direct reference in this release
`Os09g0511600`	Beta-glucosidase 31.	No verified direct reference in this release
`Os01g0813700`	Beta-glucosidase 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037063 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0005990 lactose catabolic process Biological Process

GO:0007584 response to nutrient Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009725 response to hormone Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010040 response to iron(II) ion Biological Process

GO:0010045 response to nickel cation Biological Process

GO:0010288 response to lead ion Biological Process

GO:0042594 response to starvation Biological Process

GO:0043627 response to estrogen Biological Process

GO:0045471 response to ethanol Biological Process

KEGG gene cross-reference

hsa:3938

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.322

Rank 1 · TkA04G048460 · TK1151

Endoplasmic reticulum0.286

Rank 2 · TkA04G048460 · TK1151

Cytoplasm0.100

Rank 3 · TkA04G048460 · TK1151

Plastid0.090

Rank 4 · TkA04G048460 · TK1151

Cell membrane0.066

Rank 5 · TkA04G048460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00150Cellulase12-28 aa

PF00232Glyco_hydro_135-500 aa

PF00150Cellulase90-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G048460	`PF00150`	Cellulase	12	28	0.0069	16.6
TkA04G048460	`PF00232`	Glyco_hydro_1	35	500	2.4e-140	468.8
TkA04G048460	`PF00150`	Cellulase	90	165	0.0069	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H5Q1`	Arabidopsis thaliana	sp\|B3H5Q1\|BGL11_ARATH Beta-glucosidase 11	55.100%	Swiss-Prot	High
`Q93ZI4`	Arabidopsis thaliana	sp\|Q93ZI4\|BGL10_ARATH Beta-glucosidase 10	54.400%	Swiss-Prot	High
`Q60DX8`	Oryza sativa subsp. japonica	sp\|Q60DX8\|BGL22_ORYSJ Beta-glucosidase 22	56.300%	Swiss-Prot	High
`B7F7K7`	Oryza sativa subsp. japonica	sp\|B7F7K7\|BGL31_ORYSJ Beta-glucosidase 31	53.900%	Swiss-Prot	High
`B7F8N7`	Oryza sativa subsp. japonica	sp\|B7F8N7\|BGL02_ORYSJ Beta-glucosidase 2	57.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card