TkA04G048240 | RubberDandelionOmics

Gene overview

TkA04G048240

Reference: TK1151 Chr: Chr04 Coordinates: 12933360-12935780 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

646 bp · TkA04G048240|TK1151|cDNA

GACTACCCAGAAATAGTAAAGAAGAATGCAGGAAACCGAATTCCAACTTTTACTAAAGTTGAATCAAAGAGAGTGAAGGGTTCATTCGACTTCTTTGGCATAAACCACTATAGCACATTATATGTGAAAGACGACTCCGTTAGTCTTGACATGGATACCAGAGATGCTATGGCAGACATGGCAGCGACTTATACATATGGTAGAGAAAATGAAGCTTTTCCGGATCGGTTCCCTGTGGCTCCATTGGGTCTACAAAAGCT...

CDS

Download CDS FASTA

570 bp · TkA04G048240|TK1151|CDS

GACTACCCAGAAATAGTAAAGAAGAATGCAGGAAACCGAATTCCAACTTTTACTAAAGTTGAATCAAAGAGAGTGAAGGGTTCATTCGACTTCTTTGGCATAAACCACTATAGCACATTATATGTGAAAGACGACTCCGTTAGTCTTGACATGGATACCAGAGATGCTATGGCAGACATGGCAGCGACTTATACATATGGTAGAGAAAATGAAGCTTTTCCGGATCGGTTCCCTGTGGCTCCATTGGGTCTACAAAAGCT...

Protein

Download Protein FASTA

189 aa · TkA04G048240|TK1151|PROTEIN

DYPEIVKKNAGNRIPTFTKVESKRVKGSFDFFGINHYSTLYVKDDSVSLDMDTRDAMADMAATYTYGRENEAFPDRFPVAPLGLQKLLNYVKEEYGNPAIYIHENGQLLPHDGILMDTPRIEYLHAYIGALLDALRNGSNTRGYFVWSFLDVFEVGDGYSSSFGMYYVDFDDKKLTRYPKLSAQWYARF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G048240`
TK1151 ID	TkA04G048240
OH-1004 ID	LXL04_036420
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 62.171 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G048240

Location Chr04:12933360-12935780 (-)

Description Similar to BGLU22: Beta-glucosidase 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02850`	Beta-glucosidase 11.	No verified direct reference in this release
`At3g62750`	Beta-glucosidase 8.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0366600`	Beta-glucosidase 22.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036420 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0043473 pigmentation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0016758 hexosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:BAJ33501

ag:BAJ33502

ath:AT1G02850

ath:AT3G62750

dosa:Os05g0366600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.418

Rank 1 · TkA04G048240 · TK1151

Nucleus0.155

Rank 2 · TkA04G048240 · TK1151

Extracellular0.129

Rank 3 · TkA04G048240 · TK1151

Peroxisome0.076

Rank 4 · TkA04G048240 · TK1151

Plastid0.073

Rank 5 · TkA04G048240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232Glyco_hydro_11-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G048240	`PF00232`	Glyco_hydro_1	1	188	1.9e-43	149.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H5Q1`	Arabidopsis thaliana	sp\|B3H5Q1\|BGL11_ARATH Beta-glucosidase 11	51.100%	Swiss-Prot	High
`Q67XN2`	Arabidopsis thaliana	sp\|Q67XN2\|BGL08_ARATH Beta-glucosidase 8	49.000%	Swiss-Prot	Medium
`Q60DX8`	Oryza sativa subsp. japonica	sp\|Q60DX8\|BGL22_ORYSJ Beta-glucosidase 22	50.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card