TkA04G047570 | RubberDandelionOmics

Gene overview

TkA04G047570

Reference: TK1151 Chr: Chr04 Coordinates: 12779242-12781099 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · TkA04G047570|TK1151|cDNA

ATGGGGACGACGACGGCACTGGCGTCGGGGCTTTCAAGGAAGCTGAAGCTAGGACCGGCCCTAGCTTCCGATGCCGCCCAGCAGGCTTTGGATCGGGTGGTGGAAGGGGTTAATTCCCTAGCCGAATGCTGTGACAAAATTGCCAAATCCTTGAGTAACTGTAATGCTACTACTGGAGATATCATCAGTACCACAGAAAGGCTCAAACATGAACTTGAAATCACTACTGAGAGGCAAGAGATTGCATCATGCTTCCTTCA...

CDS

Download CDS FASTA

315 bp · TkA04G047570|TK1151|CDS

ATGGGGACGACGACGGCACTGGCGTCGGGGCTTTCAAGGAAGCTGAAGCTAGGACCGGCCCTAGCTTCCGATGCCGCCCAGCAGGCTTTGGATCGGGTGGTGGAAGGGGTTAATTCCCTAGCCGAATGCTGTGACAAAATTGCCAAATCCTTGAGTAACTGTAATGCTACTACTGGAGATATCATCAGTACCACAGAAAGGCTCAAACATGAACTTGAAATCACTACTGAGAGGCAAGAGATTGCATCATGCTTCCTTCA...

Protein

Download Protein FASTA

104 aa · TkA04G047570|TK1151|PROTEIN

MGTTTALASGLSRKLKLGPALASDAAQQALDRVVEGVNSLAECCDKIAKSLSNCNATTGDIISTTERLKHELEITTERQEIASCFLQDYQLSNKEVMVFLADIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G047570`
TK1151 ID	TkA04G047570
OH-1004 ID	LXL04_036425
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.800
Protein coverage (%)	TK1151 46.154 / OH-1004 42.478 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G047570

Location Chr04:12779242-12781099 (-)

Description Similar to COG6: Conserved oligomeric Golgi complex subunit 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31780`	Required for normal Golgi function.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036425 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000301 retrograde transport, vesicle recycling within Golgi Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0007030 Golgi organization Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0017119 Golgi transport complex Cellular Component

GO:0032588 trans-Golgi network membrane Cellular Component

KEGG gene cross-reference

ath:AT1G31780

bta:509305

hsa:57511

mmu:67542

rno:310411

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.597

Rank 1 · TkA04G047570 · TK1151

Nucleus0.230

Rank 2 · TkA04G047570 · TK1151

Golgi apparatus0.179

Rank 3 · TkA04G047570 · TK1151

Cell membrane0.104

Rank 4 · TkA04G047570 · TK1151

Mitochondrion0.091

Rank 5 · TkA04G047570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20618GPD_NAD_C_bact10-50 aa

PF06419COG6_N25-97 aa

PF08650DASH_Dad427-62 aa

PF28544Helical_needle29-70 aa

PF04849HAP1_N30-101 aa

PF08650DASH_Dad461-73 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G047570	`PF20618`	GPD_NAD_C_bact	10	50	0.18	13.1
TkA04G047570	`PF06419`	COG6_N	25	97	3e-14	53.8
TkA04G047570	`PF08650`	DASH_Dad4	27	62	0.065	14.0
TkA04G047570	`PF28544`	Helical_needle	29	70	0.11	13.0
TkA04G047570	`PF04849`	HAP1_N	30	101	0.027	14.4
TkA04G047570	`PF08650`	DASH_Dad4	61	73	0.065	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NMI3`	Arabidopsis thaliana	sp\|Q6NMI3\|COG6_ARATH Conserved oligomeric Golgi complex subunit 6	66.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card