TkA04G046520 | RubberDandelionOmics

Gene overview

TkA04G046520

Reference: TK1151 Chr: Chr04 Coordinates: 12535453-12535806 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · TkA04G046520|TK1151|cDNA

ATGGGCTCAAGGAAAGCTGGGAAATCGAGTAACGTCGTCGTTTCGGAGGAACACGGATGGGTTTTTGTTGGGATTTATGACGGATTTAATGGTCCTGATGCACCTGATTATCTGTTATCAAATTTGTACCCAGCTGTTCATAAGGAACTGAAAGGTTTGCTATGGGACGATGAACTTGATTCAACGAATTTAACTCCTTCAGTGCCACCATCAGACGATGTCAAATCCCAGGTCGATAATCAACCTCTCAAAATAACCAT...

CDS

Download CDS FASTA

354 bp · TkA04G046520|TK1151|CDS

ATGGGCTCAAGGAAAGCTGGGAAATCGAGTAACGTCGTCGTTTCGGAGGAACACGGATGGGTTTTTGTTGGGATTTATGACGGATTTAATGGTCCTGATGCACCTGATTATCTGTTATCAAATTTGTACCCAGCTGTTCATAAGGAACTGAAAGGTTTGCTATGGGACGATGAACTTGATTCAACGAATTTAACTCCTTCAGTGCCACCATCAGACGATGTCAAATCCCAGGTCGATAATCAACCTCTCAAAATAACCAT...

Protein

Download Protein FASTA

117 aa · TkA04G046520|TK1151|PROTEIN

MGSRKAGKSSNVVVSEEHGWVFVGIYDGFNGPDAPDYLLSNLYPAVHKELKGLLWDDELDSTNLTPSVPPSDDVKSQVDNQPLKITIEEVSISKRVTPAHPMILIRIQIKKEVRIQE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G046520`
TK1151 ID	TkA04G046520
OH-1004 ID	LXL04_036439
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.600
Protein coverage (%)	TK1151 68.376 / OH-1004 11.571 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G046520

Location Chr04:12535453-12535806 (-)

Description Similar to PLL4: Probable protein phosphatase 2C 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28890`	Involved in leaf development regulation.	POL and related phosphatases are dosage-sensitive regulators of meristem and organ development in Arabidopsis.2005 · DOI: 10.1016/j.ydbio.2005.06.020
`At1g07630`	Involved in leaf development regulation.	POL and related phosphatases are dosage-sensitive regulators of meristem and organ development in Arabidopsis.2005 · DOI: 10.1016/j.ydbio.2005.06.020
`At5g02400`	Probable protein phosphatase 2C 66.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0275100`	Probable protein phosphatase 2C 31.	No verified direct reference in this release
`Os03g0821300`	Protein phosphatase that acts on XA21 pathogen recognition receptor.	Rice XB15, a protein phosphatase 2C, negatively regulates cell death and XA21-mediated innate immunity.2008 · DOI: 10.1371/journal.pbio.0060231

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036439 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0048366 leaf development Biological Process

GO:0048827 phyllome development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G07630

ath:AT2G28890

ath:AT3G09400

ath:AT5G02400

dosa:Os03g0821300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.412

Rank 1 · TkA04G046520 · TK1151

Cytoplasm0.375

Rank 2 · TkA04G046520 · TK1151

Cell membrane0.152

Rank 3 · TkA04G046520 · TK1151

Endoplasmic reticulum0.109

Rank 4 · TkA04G046520 · TK1151

Golgi apparatus0.062

Rank 5 · TkA04G046520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV25`	Arabidopsis thaliana	sp\|Q9ZV25\|P2C23_ARATH Probable protein phosphatase 2C 23	85.200%	Swiss-Prot	Low
`Q9LQN6`	Arabidopsis thaliana	sp\|Q9LQN6\|P2C04_ARATH Probable protein phosphatase 2C 4	83.300%	Swiss-Prot	Low
`Q9LZ86`	Arabidopsis thaliana	sp\|Q9LZ86\|P2C66_ARATH Probable protein phosphatase 2C 66	76.400%	Swiss-Prot	Low
`Q10NB9`	Oryza sativa subsp. japonica	sp\|Q10NB9\|P2C31_ORYSJ Probable protein phosphatase 2C 31	83.000%	Swiss-Prot	Low
`Q84T94`	Oryza sativa subsp. japonica	sp\|Q84T94\|P2C35_ORYSJ Protein phosphatase 2C 35	77.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card