Gene Card
Gene overview
cDNA / CDS / Protein Sequences
318 bp · TkA04G041580|TK1151|cDNA
ATGGCGATGTATCAACAACATACATACATACAGGGTGGTTATGGTGTGGTCGATAATGCATCATCAAGCTGCATGGATTGGGTCAATAAACGGAAGATAGACCAGACGTGCAGCAAGGAGGTCAAGTGTGATTGCCCACTCATGACAGTGATGATGACGGAGGATACAAGTGCCTATTGCACAAGAGTACCACCCAAAACCTACAACTCTTCCCGACCACAACCACTAGCAGTCTTAAAGACGACTCTAAACCCTAGTGA...
318 bp · TkA04G041580|TK1151|CDS
ATGGCGATGTATCAACAACATACATACATACAGGGTGGTTATGGTGTGGTCGATAATGCATCATCAAGCTGCATGGATTGGGTCAATAAACGGAAGATAGACCAGACGTGCAGCAAGGAGGTCAAGTGTGATTGCCCACTCATGACAGTGATGATGACGGAGGATACAAGTGCCTATTGCACAAGAGTACCACCCAAAACCTACAACTCTTCCCGACCACAACCACTAGCAGTCTTAAAGACGACTCTAAACCCTAGTGA...
Protein
Download Protein FASTA105 aa · TkA04G041580|TK1151|PROTEIN
MAMYQQHTYIQGGYGVVDNASSSCMDWVNKRKIDQTCSKEVKCDCPLMTVMMTEDTSAYCTRVPPKTYNSSRPQPLAVLKTTLNPSELKWTRHQPLTLGLVSEKI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G041580 |
|---|---|
| TK1151 ID | TkA04G041580 |
| OH-1004 ID | LXL04_036488 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 83.100 |
| Protein coverage (%) | TK1151 63.810 / OH-1004 42.778Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G041580 |
|---|---|
| Location | Chr04:11131109-11132426 (+) |
| Description | Similar to WOX3: WUSCHEL-related homeobox 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0009880 embryonic pattern specification Biological Process GO:0009908 flower development Biological Process GO:0009942 longitudinal axis specification Biological Process GO:0009943 adaxial/abaxial axis specification Biological Process GO:0009947 centrolateral axis specification Biological Process GO:0010482 regulation of epidermal cell division Biological Process GO:0010654 apical cell fate commitment Biological Process GO:0010865 stipule development Biological Process GO:0030154 cell differentiation Biological Process GO:0048825 cotyledon development Biological Process |
| KEGG gene cross-reference | ath:AT2G28610 ath:AT5G59340 osa:107275686 zma:542147 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.