TkA04G040370 | RubberDandelionOmics

Gene overview

TkA04G040370

Reference: TK1151 Chr: Chr04 Coordinates: 10806125-10808742 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1887 bp · TkA04G040370|TK1151|cDNA

GCAGTCCTCCTCTAACCTTTTACCATCATCGCACAACTCCTTCTGCTCATCTTCCGTTACTGAGTTCGCGCGACGTCGTATTTGACCTTTCTACCCGCACTGGGTCCCACTCAACTCCCCTCCCCTTTCTTGCCTTCTACACCGCCACTGCGAGTGTCTGCAATTTCCGATTCCTCCCTTTACATTCTCTCCCACCCTCTCTCTCTCTCTCTAACTTTCTCTCTCTATATATATAGTTAGTTATATATATAATATGGTAA...

CDS

Download CDS FASTA

1299 bp · TkA04G040370|TK1151|CDS

ATGGTGGTTCAAGAATCTGAAATTATGTCTCCCGGTGAAGTTGAATCCCCAATGCAATCCGATCAACACCAGTCTAGAAACAATGTCGTCCAAAACCCCCCACCGCCGCAGCTCGGCCGGCAATCTTCCATCTATTCTCTCACCTTAGATGAATTTCAGCACACTCTTTGCGAAAGTGGGAAAAACTTCGGTTCGATGAACATGGATGAGTTCCTCAACAGTATTTGGACTGCTGAAGAGAATCAGGCTCATGGACAAGG...

Protein

Download Protein FASTA

432 aa · TkA04G040370|TK1151|PROTEIN

MVVQESEIMSPGEVESPMQSDQHQSRNNVVQNPPPPQLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLNSIWTAEENQAHGQGHPPAAAAAGGSTSTPAAVAPNGSGQMLMGIHTGNSAQQNMISKQHSLPRQGSLTLPGPLSRKTVDEVWSEIQKTQHEHQQPSSNSGNAQVPGSAQRQPTYGEMTLEDFLVKAGVVREQNHPNAPPVQQPPPAPFGLYPNGNNRVVGPPPGSAHMGRPVNAIPPYSPLIREAPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G040370`
TK1151 ID	TkA04G040370
OH-1004 ID	LXL04_036504
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G040370

Location Chr04:10806125-10808742 (-)

Description Similar to ABI5: Protein ABSCISIC ACID-INSENSITIVE 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36270`	Participates in ABA-regulated gene expression during seed development and subsequent vegetative stage by acting as the major mediator of ABA repression of growth.	A postgermination developmental arrest checkpoint is mediated by abscisic acid and requires the ABI5 transcription factor in Arabidopsis.2001 · DOI: 10.1073/pnas.081594298 Regulation of Arabidopsis thaliana Em genes: role of ABI5.2002 · DOI: 10.1046/j.1365-313x.2002.01295.x The homologous ABI5 and EEL transcription factors function antagonistically to fine-tune gene expression during late embryogenesis.2002 · DOI: 10.1105/tpc.000869 Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response.2002 · DOI: 10.1104/pp.005793 ABI5 acts downstream of ABI3 to execute an ABA-dependent growth arrest during germination.2002 · DOI: 10.1046/j.1365-313x.2002.01430.x Mitogen-activated protein kinase signaling in postgermination arrest of development by abscisic acid.2002 · DOI: 10.1073/pnas.242607499 Interactions of abscisic acid and sugar signalling in the regulation of leaf senescence.2004 · DOI: 10.1007/s00425-004-1279-5 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5 Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At3g44460`	Could participate in abscisic acid-regulated gene expression during seed development.	No verified direct reference in this release
`At1g45249`	Involved in ABA and stress responses and acts as a positive component of glucose signal transduction.	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 AREB1 is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.2005 · DOI: 10.1105/tpc.105.035659 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5
`At3g56850`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0859300`	May act as a transcription factor with transactivation activity observed in yeast.	A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance.2008 · DOI: 10.1007/s11103-008-9298-4 Phosphorylation-mediated regulation of a rice ABA responsive element binding factor.2011 · DOI: 10.1016/j.phytochem.2010.10.005 A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth.2012 · DOI: 10.1093/jxb/err338
`Os02g0766700`	Transcriptional activator that mediates abscisic acid (ABA) signaling.	Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice.2008 · DOI: 10.1104/pp.108.128199 Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes.2016 · DOI: 10.1104/pp.16.00469 OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036504 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0010152 pollen maturation Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G45249

ath:AT1G49720

ath:AT2G36270

dosa:Os01g0859300

dosa:Os06g0211200

osa:4325061

osa:4340462

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · TkA04G040370 · TK1151

Cytoplasm0.132

Rank 2 · TkA04G040370 · TK1151

Cell membrane0.027

Rank 3 · TkA04G040370 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA04G040370 · TK1151

Mitochondrion0.007

Rank 5 · TkA04G040370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03131bZIP_Maf43-56 aa

PF03131bZIP_Maf65-80 aa

PF08286Spc24153-167 aa

PF03131bZIP_Maf157-166 aa

PF14661HAUS6_N344-422 aa

PF07716bZIP_2346-396 aa

PF00170bZIP_1347-399 aa

PF03131bZIP_Maf347-401 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G040370	`PF03131`	bZIP_Maf	43	56	0.0018	19.5
TkA04G040370	`PF03131`	bZIP_Maf	65	80	0.0018	19.5
TkA04G040370	`PF08286`	Spc24	153	167	5.7	7.9
TkA04G040370	`PF03131`	bZIP_Maf	157	166	0.0018	19.5
TkA04G040370	`PF14661`	HAUS6_N	344	422	0.82	9.9
TkA04G040370	`PF07716`	bZIP_2	346	396	7.2e-10	39.5
TkA04G040370	`PF00170`	bZIP_1	347	399	7.6e-12	45.9
TkA04G040370	`PF03131`	bZIP_Maf	347	401	0.0018	19.5
TkA04G040370	`PF05325`	DUF730	360	407	0.3	11.8
TkA04G040370	`PF03961`	FapA	366	422	0.19	12.0
TkA04G040370	`PF08286`	Spc24	372	408	5.7	7.9
TkA04G040370	`PF05377`	FlaC_arch	373	397	0.33	12.1
TkA04G040370	`PF07716`	bZIP_2	407	425	7.2e-10	39.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJN0`	Arabidopsis thaliana	sp\|Q9SJN0\|ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5	48.100%	Swiss-Prot	Medium
`Q8RYD6`	Arabidopsis thaliana	sp\|Q8RYD6\|AI5L1_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 1	38.400%	Swiss-Prot	Medium
`Q9M7Q4`	Arabidopsis thaliana	sp\|Q9M7Q4\|AI5L5_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 5	39.300%	Swiss-Prot	Medium
`Q9LES3`	Arabidopsis thaliana	sp\|Q9LES3\|AI5L2_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 2	37.200%	Swiss-Prot	Medium
`Q8RZ35`	Oryza sativa subsp. japonica	sp\|Q8RZ35\|ABI5_ORYSJ bZIP transcription factor ABI5 homolog	42.400%	Swiss-Prot	Medium
`Q6Z312`	Oryza sativa subsp. japonica	sp\|Q6Z312\|BZP23_ORYSJ bZIP transcription factor 23	39.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card