TkA04G038730 | RubberDandelionOmics

Gene overview

TkA04G038730

Reference: TK1151 Chr: Chr04 Coordinates: 10389752-10393763 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3011 bp · TkA04G038730|TK1151|cDNA

TCTTTAAAGCTAAGTATTAATTTTGATGTTGAAGAACAGGGGGCGAATTTTAAAACAGCCAAAGAACAGGGGAGTTGCATAGCTTGTGGAAACTGTCTTTCTGGTTGTCCTTACAATGCAAAAAATTCCACTGACAAAAATTATCTCTTCACTGCCGTTGAGGCTGGATGTAATATCAAAACAGATTGTGAAGTTAAGTATGTGGTGAAAAACCCGAACAACACAAATATACACGGGAAACGAGCACGTAGGTGGCTCGT...

CDS

Download CDS FASTA

3309 bp · TkA04G038730|TK1151|CDS

ATGTCCATGGCGGGAATAAACGTTTGTTTGCTTGAAAAAGGTCGAAAATGGGAATCTCAAGATTTTCCTACAGATAGTTTGAAATTGTTATCGTCTATTAGATACGAAAACAAACGCTTAGGGATCGGTTTAGGCCCAAAAGATGCATTGTTCAAGATACACACAGAAGATGATTCATTAGCAGTAACGGTTTGTGGTCTTGGTGGTGGTTCACTAGTGAACGCTGGTGTGATGCTATCAACACCTGTTCGAGCAAAAAG...

Protein

Download Protein FASTA

1102 aa · TkA04G038730|TK1151|PROTEIN

MSMAGINVCLLEKGRKWESQDFPTDSLKLLSSIRYENKRLGIGLGPKDALFKIHTEDDSLAVTVCGLGGGSLVNAGVMLSTPVRAKRNPKWPKEWESDWKSCEASASSMLNIQNGANFKTAKEQGSCIACGNCLSGCPYNAKNSTDKNYLFTAVEAGCNIKTDCEVKYVVKNPNNTNIHGKRARRWLVFINETDYLQSDFVILSGGVFGTTDLLFRSQTRGLELSSRLGEGFSCNGNNSAYLAGSTIPLGGYGLQKEQFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G038730`
TK1151 ID	TkA04G038730
OH-1004 ID	LXL04_036524
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 97.099 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G038730

Location Chr04:10389752-10393763 (-)

Description Similar to choD: Cholesterol oxidase (Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03990`	Long-chain fatty alcohol oxidase involved in the omega-oxidation pathway of lipid degradation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036524 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006066 alcohol metabolic process Biological Process

GO:0006707 cholesterol catabolic process Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

GO:0004769 steroid Delta-isomerase activity Molecular Function

GO:0016995 cholesterol oxidase activity Molecular Function

GO:0046577 long-chain-alcohol oxidase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

KEGG gene cross-reference

ag:CAP15762

mtc:MT3517

mtu:Rv3409c

mtv:RVBD_3409c

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.380

Rank 1 · TkA04G038730 · TK1151

Endoplasmic reticulum0.199

Rank 2 · TkA04G038730 · TK1151

Cytoplasm0.193

Rank 3 · TkA04G038730 · TK1151

Peroxisome0.123

Rank 4 · TkA04G038730 · TK1151

Nucleus0.094

Rank 5 · TkA04G038730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00732GMC_oxred_N66-94 aa

PF13187Fer4_9100-141 aa

PF14697Fer4_21100-139 aa

PF12838Fer4_7101-141 aa

PF00732GMC_oxred_N120-217 aa

PF12797Fer4_2123-139 aa

PF12837Fer4_6124-141 aa

PF13237Fer4_10124-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G038730	`PF00732`	GMC_oxred_N	66	94	3.3e-11	44.1
TkA04G038730	`PF13187`	Fer4_9	100	141	0.00029	21.5
TkA04G038730	`PF14697`	Fer4_21	100	139	0.0088	16.9
TkA04G038730	`PF12838`	Fer4_7	101	141	0.004	18.3
TkA04G038730	`PF00732`	GMC_oxred_N	120	217	3.3e-11	44.1
TkA04G038730	`PF12797`	Fer4_2	123	139	2.7	8.9
TkA04G038730	`PF12837`	Fer4_6	124	141	0.022	15.4
TkA04G038730	`PF13237`	Fer4_10	124	143	0.093	13.4
TkA04G038730	`PF00037`	Fer4	125	141	0.0029	18.1
TkA04G038730	`PF13183`	Fer4_8	126	147	0.14	13.4
TkA04G038730	`PF05199`	GMC_oxred_C	385	451	1.4e-08	36.1
TkA04G038730	`PF12797`	Fer4_2	905	913	2.7	8.9
TkA04G038730	`PF13187`	Fer4_9	907	913	0.00029	21.5
TkA04G038730	`PF12837`	Fer4_6	909	913	0.022	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZWB9`	Arabidopsis thaliana	sp\|Q9ZWB9\|FAO1_ARATH Long-chain-alcohol oxidase FAO1	21.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card