TkA04G038160 | RubberDandelionOmics

Gene overview

TkA04G038160

Reference: TK1151 Chr: Chr04 Coordinates: 10210790-10215222 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1988 bp · TkA04G038160|TK1151|cDNA

ATACACCGTGGTCTATGAACTAGAAGTGCAGTAAATGCGAGATAAATGAGGGACTCATGCACAGCCCTAAACTCACCAAAATCCGCAGAATCTCTACAGTTGAAGCACTCTACCAAACTCCGGAAGAAGACACCAAACACATAATCCGCCACCTCCTTCCAATGTTCTTCTGACTATCAATGGAAACCCTAGCTATCTCCCACCGCCTTCTCCCGCCATCTCTCCACCGTTCCTCCATTAATCACCGCCTTTCCTCCCTT...

CDS

Download CDS FASTA

927 bp · TkA04G038160|TK1151|CDS

ATGGAAACCCTAGCTATCTCCCACCGCCTTCTCCCGCCATCTCTCCACCGTTCCTCCATTAATCACCGCCTTTCCTCCCTTCCTCCCTCCCTCGCTCTCTCCAGCTCCACCTCCACTTCTCGTTCCTTCACTCTCAAATGCTCTGCTCGATCTCCATCTCCAACCGCATCAGTTGACCATTCAGTGAAATTCAAGGAAGCTGCAAAGGATGGGAATCTGATTCCATTATACAGGTCAATATTCTCTGATCATTTGACTCC...

Protein

Download Protein FASTA

308 aa · TkA04G038160|TK1151|PROTEIN

METLAISHRLLPPSLHRSSINHRLSSLPPSLALSSSTSTSRSFTLKCSARSPSPTASVDHSVKFKEAAKDGNLIPLYRSIFSDHLTPVLAYRCLVKEDDRDAPSFLFESVEPGLKASSVGRYSVIGAQPTMEIVAKENMVTVMDHHEGVKTEEFVEDPMVVPRRIMEQWKPQRIDELPDAFCGGWVGYFSYDTVRYVEKKKIPFSNAPLDDRNLPDVHLGLYDDVIVFDHIEKKAYVIHWVRLDQYSSVDEAFKDGTDRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G038160`
TK1151 ID	TkA04G038160
OH-1004 ID	LXL04_036538
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.026 / OH-1004 51.959 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G038160

Location Chr04:10210790-10215222 (-)

Description Similar to ASA2: Anthranilate synthase alpha subunit 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29690`	Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	No verified direct reference in this release
`At5g05730`	Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	A Link between ethylene and auxin uncovered by the characterization of two root-specific ethylene-insensitive mutants in Arabidopsis.2005 · DOI: 10.1105/tpc.105.033365 Arabidopsis ASA1 is important for jasmonate-mediated regulation of auxin biosynthesis and transport during lateral root formation.2009 · DOI: 10.1105/tpc.108.064303

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XNK3`	Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	No verified direct reference in this release
`Os03g0826500`	Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	Characterization of rice anthranilate synthase alpha-subunit genes OASA1 and OASA2. Tryptophan accumulation in transgenic rice expressing a feedback-insensitive mutant of OASA1.2001 · DOI: 10.1104/pp.126.4.1493 In vitro reconstitution of rice anthranilate synthase: distinct functional properties of the alpha subunits OASA1 and OASA2.2004 · DOI: 10.1023/b:plan.0000028729.79034.07
`Os03g0264400`	Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	In vitro reconstitution of rice anthranilate synthase: distinct functional properties of the alpha subunits OASA1 and OASA2.2004 · DOI: 10.1023/b:plan.0000028729.79034.07

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036538 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005950 anthranilate synthase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004049 anthranilate synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G29690

ath:AT5G05730

dosa:Os03g0264400

dosa:Os03g0826500

osa:4332341

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.920

Rank 1 · TkA04G038160 · TK1151

Nucleus0.081

Rank 2 · TkA04G038160 · TK1151

Mitochondrion0.049

Rank 3 · TkA04G038160 · TK1151

Cytoplasm0.039

Rank 4 · TkA04G038160 · TK1151

Cell membrane0.028

Rank 5 · TkA04G038160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00425Chorismate_bind155-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G038160	`PF00425`	Chorismate_bind	155	304	6e-07	29.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P32069`	Arabidopsis thaliana	sp\|P32069\|TRPX_ARATH Anthranilate synthase alpha subunit 2, chloroplastic	63.100%	Swiss-Prot	High
`P32068`	Arabidopsis thaliana	sp\|P32068\|TRPE_ARATH Anthranilate synthase alpha subunit 1, chloroplastic	60.400%	Swiss-Prot	High
`A2XNK3`	Oryza sativa subsp. indica	sp\|A2XNK3\|ASA1_ORYSI Anthranilate synthase alpha subunit 1, chloroplastic	66.800%	Swiss-Prot	High
`Q94GF1`	Oryza sativa subsp. japonica	sp\|Q94GF1\|ASA1_ORYSJ Anthranilate synthase alpha subunit 1, chloroplastic	66.800%	Swiss-Prot	High
`Q9XJ29`	Oryza sativa subsp. japonica	sp\|Q9XJ29\|ASA2_ORYSJ Anthranilate synthase alpha subunit 2, chloroplastic	63.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card