TkA04G036720 | RubberDandelionOmics

Gene overview

TkA04G036720

Reference: TK1151 Chr: Chr04 Coordinates: 9821193-9824188 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2111 bp · TkA04G036720|TK1151|cDNA

ATATAATATCGAATGGACTAGTCGCCGGAGCCGTCTATAAATAAGCGGCGAATGAAGCGGTGATAACCAATCAATTCATCCTCACCCTCCACATTTTACACGGTCATCTTCGCTCCATTCTTCCTTTTCTCCCGCCGTTAAAATTTGTTATTTGTGCATCATTACTTTGCGGTAGCCATGTGTGGAATACTAGCCGTGTTGGGTTGCTCCGATGATTCTCAGGCCAAAAGGGTCCGTGTCCTCGAGCTCTCTCGCAGATT...

CDS

Download CDS FASTA

1770 bp · TkA04G036720|TK1151|CDS

ATGTGTGGAATACTAGCCGTGTTGGGTTGCTCCGATGATTCTCAGGCCAAAAGGGTCCGTGTCCTCGAGCTCTCTCGCAGATTGAAGCACCGTGGTCCAGATTGGAGTGGGTTATATCAGTTCGGTGATTGTTATCTGGCGCATCAACGTCTCGCCATCATCGACCCTGCTTCCGGTGATCAACCCCTCTATAACGAAGACGGAACAATCGTTGTCACGGTTAACGGTGAGATATACAACCATGAACAGCTCCGAGAAAG...

Protein

Download Protein FASTA

589 aa · TkA04G036720|TK1151|PROTEIN

MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQFGDCYLAHQRLAIIDPASGDQPLYNEDGTIVVTVNGEIYNHEQLRESLTGHKFKTGSDCDVIAHLYEEHGENFIDMLDGMFSFVLLDTRSNTYIAARDAIGITPLYIGWGLDGSVWISSEMKGLNDDCEHFEVFPPGHLYSSKTGGFRRWYNPQWFSEAIPSTPYDPLVLRHAFEDAVIKRLMTDVPFGVLLSGGLDSSLVASITARHMATTKAAKQWGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G036720`
TK1151 ID	TkA04G036720
OH-1004 ID	LXL04_018682
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 5.433 / OH-1004 19.048 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G036720

Location Chr04:9821193-9824188 (+)

Description Similar to Prep: Prolyl endopeptidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47340`	Essential for nitrogen assimilation, distribution and remobilization within the plant via the phloem.	Overexpression of the ASN1 gene enhances nitrogen status in seeds of Arabidopsis.2003 · DOI: 10.1104/pp.103.020123

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018682 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002003 angiotensin maturation Biological Process

GO:0006508 proteolysis Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004181 metallocarboxypeptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

KEGG gene cross-reference

bta:286818

hsa:5550

mmu:19072

rno:83471

ssc:445540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.671

Rank 1 · TkA04G036720 · TK1151

Nucleus0.211

Rank 2 · TkA04G036720 · TK1151

Peroxisome0.134

Rank 3 · TkA04G036720 · TK1151

Mitochondrion0.122

Rank 4 · TkA04G036720 · TK1151

Cell membrane0.047

Rank 5 · TkA04G036720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13522GATase_61-168 aa

PF13537GATase_748-165 aa

PF12481DUF3700112-202 aa

PF24712YxiG_2188-294 aa

PF00733Asn_synthase210-361 aa

PF02540NAD_synthase229-253 aa

PF13522GATase_6325-376 aa

PF00733Asn_synthase359-511 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G036720	`PF13522`	GATase_6	1	168	1.6e-52	178.8
TkA04G036720	`PF13537`	GATase_7	48	165	7.6e-40	136.5
TkA04G036720	`PF12481`	DUF3700	112	202	4.8e-11	43.3
TkA04G036720	`PF24712`	YxiG_2	188	294	0.032	15.0
TkA04G036720	`PF00733`	Asn_synthase	210	361	1.3e-86	292.2
TkA04G036720	`PF02540`	NAD_synthase	229	253	0.16	11.8
TkA04G036720	`PF13522`	GATase_6	325	376	1.6e-52	178.8
TkA04G036720	`PF00733`	Asn_synthase	359	511	1.3e-86	292.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49078`	Arabidopsis thaliana	sp\|P49078\|ASNS1_ARATH Asparagine synthetase [glutamine-hydrolyzing] 1	81.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card