TkA04G035230 | RubberDandelionOmics

Gene overview

TkA04G035230

Reference: TK1151 Chr: Chr04 Coordinates: 9465733-9468479 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1604 bp · TkA04G035230|TK1151|cDNA

AAAAAAACTAACCAAATAAGGATCAAATTTACAACTATAGAAAAAAATGACAAACCACGTGGAACATTCTACTCTGGAATCATCAACGAACCTGTACGATTCTATCCCCCCCTTCATCAAACTATTGAATCATCCTTTATGATCAAATCCAGAACAAAATTATGGCCGTAATTGCACAAACTGTGATTAATTAAACATGATTAAATTCGAATTATACGGCTGTAGCTATAGGTTATTCCAATTTCTTCCCCTCATTCATT...

CDS

Download CDS FASTA

966 bp · TkA04G035230|TK1151|CDS

ATGGCTTCCTCTCTTTGCGCAATCCACCCTTTCTCGTCGTGTTCTTTTCGTGATCCGAGATTCCGCCTGCCGGATTCGCGTTTTACAGCAACGTATTCCACTCTTGTTTCTTCCACCATTCCTAATGCTTCTTCTACCATTACTCGAAATGGTAGATTTAGCTTCGATTTCTCCCTCCAAAAGTTAAATCCTAATGTAAGTCCTCGGAGAATAAGGTCAGCGGCAGCTGCCGGACCTATGTTCTTCCCGGAGAATCCCCT...

Protein

Download Protein FASTA

321 aa · TkA04G035230|TK1151|PROTEIN

MASSLCAIHPFSSCSFRDPRFRLPDSRFTATYSTLVSSTIPNASSTITRNGRFSFDFSLQKLNPNVSPRRIRSAAAAGPMFFPENPLVGDICAMVFSGCFALSILRIYEETARRGVFDQKLNRKLVHTTIGLAFMLCWPLFSSGNQGAVLAALIPGVNIVKVLLIGLGIWKDEAAVKSMSRYGDYRELIKGPLYYASTIALSSIIYWRTSPIAIAAICNLCAGDGMADIIGRRFGNKKIPYNKDKSFAGSIAMAASGFIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G035230`
TK1151 ID	TkA04G035230
OH-1004 ID	LXL04_036587
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.600
Protein coverage (%)	TK1151 70.405 / OH-1004 93.286 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G035230

Location Chr04:9465733-9468479 (+)

Description Similar to Probable phytol kinase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58560`	Kinase involved in negative regulation of abscisic acid (ABA) signaling.	Farnesol kinase is involved in farnesol metabolism, ABA signaling and flower development in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04572.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0832000`	Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036587 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006720 isoprenoid metabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0016487 farnesol metabolic process Biological Process

GO:0048440 carpel development Biological Process

GO:0009507 chloroplast Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0010276 phytol kinase activity Molecular Function

GO:0016301 kinase activity Molecular Function

GO:0052673 prenol kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G04490

ath:AT5G58560

gmx:100788252

gmx:100793696

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · TkA04G035230 · TK1151

Mitochondrion0.028

Rank 2 · TkA04G035230 · TK1151

Nucleus0.018

Rank 3 · TkA04G035230 · TK1151

Cytoplasm0.012

Rank 4 · TkA04G035230 · TK1151

Cell membrane0.011

Rank 5 · TkA04G035230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14126DUF4293146-181 aa

PF14126DUF4293267-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G035230	`PF14126`	DUF4293	146	181	0.23	12.3
TkA04G035230	`PF14126`	DUF4293	267	286	0.23	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67ZM7`	Arabidopsis thaliana	sp\|Q67ZM7\|FOLK_ARATH Farnesol kinase, chloroplastic	61.100%	Swiss-Prot	High
`Q5N9J9`	Oryza sativa subsp. japonica	sp\|Q5N9J9\|PHYK2_ORYSJ Probable phytol kinase 2, chloroplastic	61.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card