TkA04G034870 | RubberDandelionOmics

Gene overview

TkA04G034870

Reference: TK1151 Chr: Chr04 Coordinates: 9361955-9363229 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

585 bp · TkA04G034870|TK1151|cDNA

ATGCCACCTCCGGCCTCCGATTCCACCTCCGGCACACACAGAACACAAACGCCGATCGAAGCAGCTCCGATCTCATCCTCTGTCGCTGCCAGACGCCGATCCCACCTCCGGCCTCCGATTCCACCTCCGGCACACACAGGTTCCCAAAGAGCAAGTGAATGCAGCATGGCTGCTTTCTATGCCGGCTTTCCTGTACAAGAAAATGGAATTCAGGATTCCATTCCATGGAACCCAAAAGTCAAGACCATGGCACAAGCCCA...

CDS

Download CDS FASTA

585 bp · TkA04G034870|TK1151|CDS

ATGCCACCTCCGGCCTCCGATTCCACCTCCGGCACACACAGAACACAAACGCCGATCGAAGCAGCTCCGATCTCATCCTCTGTCGCTGCCAGACGCCGATCCCACCTCCGGCCTCCGATTCCACCTCCGGCACACACAGGTTCCCAAAGAGCAAGTGAATGCAGCATGGCTGCTTTCTATGCCGGCTTTCCTGTACAAGAAAATGGAATTCAGGATTCCATTCCATGGAACCCAAAAGTCAAGACCATGGCACAAGCCCA...

Protein

Download Protein FASTA

194 aa · TkA04G034870|TK1151|PROTEIN

MPPPASDSTSGTHRTQTPIEAAPISSSVAARRRSHLRPPIPPPAHTGSQRASECSMAAFYAGFPVQENGIQDSIPWNPKVKTMAQAQDCLLPMGITSENVAQRFSVESHRKAAAATAAGIFKDEIIPIPTKIVDPKTGDETPITVSVDDGIRPGVTLSDSDVNYKTVSSKQRLLLDIDIDDIDIDIATTTLRGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G034870`
TK1151 ID	TkA04G034870
OH-1004 ID	LXL04_004000
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.800
Protein coverage (%)	TK1151 58.247 / OH-1004 34.820 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G034870

Location Chr04:9361955-9363229 (+)

Description Similar to PED1: 3-ketoacyl-CoA thiolase 2, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33150`	Involved in long chain fatty-acid beta-oxidation prior to gluconeogenesis during germination and subsequent seedling growth.	Evidence supporting a role of jasmonic acid in Arabidopsis leaf senescence.2002 · DOI: 10.1104/pp.010843 Gene-specific involvement of beta-oxidation in wound-activated responses in Arabidopsis.2004 · DOI: 10.1104/pp.104.039925 Arabidopsis 3-ketoacyl-CoA thiolase-2 (KAT2), an enzyme of fatty acid β-oxidation, is involved in ABA signal transduction.2011 · DOI: 10.1093/pcp/pcr008 2,4-Dichlorophenoxybutyric acid-resistant mutants of Arabidopsis have defects in glyoxysomal fatty acid beta-oxidation.1998 · DOI: 10.1105/tpc.10.2.183
`At1g04710`	Involved in fatty-acid beta-oxidation prior to gluconeogenesis during germination and subsequent seedling growth.	No verified direct reference in this release
`At5g48880`	Probably involved in long chain fatty-acid beta-oxidation prior to gluconeogenesis during germination and subsequent seedling growth.	Requirement for 3-ketoacyl-CoA thiolase-2 in peroxisome development, fatty acid beta-oxidation and breakdown of triacylglycerol in lipid bodies of Arabidopsis seedlings.2001 · DOI: 10.1046/j.1365-313x.2001.01095.x Gene-specific involvement of beta-oxidation in wound-activated responses in Arabidopsis.2004 · DOI: 10.1104/pp.104.039925

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004000 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010111 glyoxysome organization Biological Process

GO:0010124 phenylacetate catabolic process Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT1G04710

ath:AT2G33150

ath:AT5G48880

rno:501072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.394

Rank 1 · TkA04G034870 · TK1151

Nucleus0.391

Rank 2 · TkA04G034870 · TK1151

Cell membrane0.136

Rank 3 · TkA04G034870 · TK1151

Mitochondrion0.104

Rank 4 · TkA04G034870 · TK1151

Endoplasmic reticulum0.084

Rank 5 · TkA04G034870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02429PCP79-118 aa

PF00108Thiolase_N92-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G034870	`PF02429`	PCP	79	118	0.2	12.7
TkA04G034870	`PF00108`	Thiolase_N	92	158	9.1e-10	39.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56WD9`	Arabidopsis thaliana	sp\|Q56WD9\|THIK2_ARATH 3-ketoacyl-CoA thiolase 2, peroxisomal	53.400%	Swiss-Prot	Medium
`Q8LF48`	Arabidopsis thaliana	sp\|Q8LF48\|THIK1_ARATH 3-ketoacyl-CoA thiolase 1, peroxisomal	51.500%	Swiss-Prot	Medium
`Q570C8`	Arabidopsis thaliana	sp\|Q570C8\|THIK5_ARATH 3-ketoacyl-CoA thiolase 5, peroxisomal	42.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card