TkA04G034540 | RubberDandelionOmics

Gene overview

TkA04G034540

Reference: TK1151 Chr: Chr04 Coordinates: 9268496-9269146 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · TkA04G034540|TK1151|cDNA

ATGGATTTAGCATCCGGAACAGGGTCAAACGATCCGGGTCCATCGCCGACTGGTGGTCCTGCCGACTCCTCCTCCTCCGCCGCAAGGTCAACGCCTCATACACCACCAACAACACCGAGCAGATACGAGTCTCAAAAACGACGCGACTGGAATACGTTCTTACAGTACCTGAGCAACCACAAGCCGCCGTTAACGCTGGCGAGGTGCAGCGGAGCTCACGTCATCGAGTTCCTTAAATACCTTGACCAGTTCGGGAAAAC...

CDS

Download CDS FASTA

609 bp · TkA04G034540|TK1151|CDS

ATGGATTTAGCATCCGGAACAGGGTCAAACGATCCGGGTCCATCGCCGACTGGTGGTCCTGCCGACTCCTCCTCCTCCGCCGCAAGGTCAACGCCTCATACACCACCAACAACACCGAGCAGATACGAGTCTCAAAAACGACGCGACTGGAATACGTTCTTACAGTACCTGAGCAACCACAAGCCGCCGTTAACGCTGGCGAGGTGCAGCGGAGCTCACGTCATCGAGTTCCTTAAATACCTTGACCAGTTCGGGAAAAC...

Protein

Download Protein FASTA

202 aa · TkA04G034540|TK1151|PROTEIN

MDLASGTGSNDPGPSPTGGPADSSSSAARSTPHTPPTTPSRYESQKRRDWNTFLQYLSNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHVTDCPYFGQPNPPAPCVCQLKQAWGSLDALIGRLRAAYDENGGRPEANPFGARAVRMYLREVRESQAKARGIPYEKKRKRPGGNGGGGGGVEDDGGADAAVISSRSPASSTH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G034540`
TK1151 ID	TkA04G034540
OH-1004 ID	LXL04_036602
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G034540

Location Chr04:9268496-9269146 (-)

Description Similar to LSH6: Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07090`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Y3I2`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release
`Os05g0347400`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release
`UniProt: A2XED8`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release
`Os01g0828900`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036602 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009299 mRNA transcription Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0090698 post-embryonic plant morphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G07090

ath:AT5G58500

dosa:Os05g0347400

osa:107278610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.925

Rank 1 · TkA04G034540 · TK1151

Cytoplasm0.174

Rank 2 · TkA04G034540 · TK1151

Mitochondrion0.027

Rank 3 · TkA04G034540 · TK1151

Cell membrane0.017

Rank 4 · TkA04G034540 · TK1151

Extracellular0.012

Rank 5 · TkA04G034540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04852ALOG_dom33-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G034540	`PF04852`	ALOG_dom	33	154	6.3e-65	217.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMK2`	Arabidopsis thaliana	sp\|Q9LMK2\|LSH6_ARATH Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6	86.600%	Swiss-Prot	Medium
`A2Y3I2`	Oryza sativa subsp. indica	sp\|A2Y3I2\|G1L9_ORYSI Protein G1-like9	87.500%	Swiss-Prot	Medium
`Q5W659`	Oryza sativa subsp. japonica	sp\|Q5W659\|G1L9_ORYSJ Protein G1-like9	87.500%	Swiss-Prot	Medium
`A2XED8`	Oryza sativa subsp. indica	sp\|A2XED8\|G1L7_ORYSI Protein G1-like7	81.300%	Swiss-Prot	Medium
`Q941W1`	Oryza sativa subsp. japonica	sp\|Q941W1\|G1L7_ORYSJ Protein G1-like7	81.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card