TkA04G032890 | RubberDandelionOmics

Gene overview

TkA04G032890

Reference: TK1151 Chr: Chr04 Coordinates: 8796617-8800972 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2004 bp · TkA04G032890|TK1151|cDNA

ATGGCGGAAGTGCATTCGACTTCGTCGTCTACGGCCGCAAAACCAGCGACTAGCCCCGATCCCGAAGCGATTCCCAACGAGAAATGGGTCGCCGGCGAAGACCCGATTCTTCAGGTGTTGAATTGTGTATACCCTACATTGGATTCGGAAGAGAAGAGGAAAGACGTGATTGAATTCATGCAGAAGCTCATCAGAAGTTCACTCGGAGTTGAGGTGTTCCCATATGGTTCAACACCACTCAAGACTTATCTCCCTGATGG...

CDS

Download CDS FASTA

2004 bp · TkA04G032890|TK1151|CDS

ATGGCGGAAGTGCATTCGACTTCGTCGTCTACGGCCGCAAAACCAGCGACTAGCCCCGATCCCGAAGCGATTCCCAACGAGAAATGGGTCGCCGGCGAAGACCCGATTCTTCAGGTGTTGAATTGTGTATACCCTACATTGGATTCGGAAGAGAAGAGGAAAGACGTGATTGAATTCATGCAGAAGCTCATCAGAAGTTCACTCGGAGTTGAGGTGTTCCCATATGGTTCAACACCACTCAAGACTTATCTCCCTGATGG...

Protein

Download Protein FASTA

667 aa · TkA04G032890|TK1151|PROTEIN

MAEVHSTSSSTAAKPATSPDPEAIPNEKWVAGEDPILQVLNCVYPTLDSEEKRKDVIEFMQKLIRSSLGVEVFPYGSTPLKTYLPDGDIDFTAIGPPGRGNILPHDVLHLLQAQEYYGNNEFEIRDVTFIDAEVKLVKCIVSGIVIDISFNMLGGLCTLCFLEQVDRHIGNDHIFKRSIILIKTWCFYESRLLGANYGLLSTYALAVLVLYIFQVFGASITSPLMALYRFLDYYSKFDWDNYCINLNGVVNKSSLPDIVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G032890`
TK1151 ID	TkA04G032890
OH-1004 ID	LXL04_036639
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G032890`
Location	Chr04:8796617-8800972 (+)
Description	Similar to HESO1: Protein HESO1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036639` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006397 mRNA processing Biological Process GO:0010587 miRNA catabolic process Biological Process GO:0016077 sno(s)RNA catabolic process Biological Process GO:0031123 RNA 3'-end processing Biological Process GO:0034475 U4 snRNA 3'-end processing Biological Process GO:0043634 polyadenylation-dependent ncRNA catabolic process Biological Process GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process Biological Process GO:0071038 TRAMP-dependent tRNA surveillance pathway Biological Process GO:0071040 nuclear polyadenylation-dependent antisense transcript catabolic process Biological Process GO:0140746 siRNA catabolic process Biological Process GO:1990431 priRNA 3'-end processing Biological Process GO:0000932 P-body Cellular Component
KEGG gene cross-reference	ath:AT2G39740 spo:3361384 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.621

Rank 1 · TkA04G032890 · TK1151

Nucleus0.361

Rank 2 · TkA04G032890 · TK1151

Cell membrane0.089

Rank 3 · TkA04G032890 · TK1151

Endoplasmic reticulum0.064

Rank 4 · TkA04G032890 · TK1151

Lysosome / Vacuole0.051

Rank 5 · TkA04G032890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22600MTPAP-like_central36-156 aa

PF01909NTP_transf_257-119 aa

PF22812CR_prot_dom_plant114-162 aa

PF26180PAP-OAS1169-361 aa

PF17406Nrap_D5175-248 aa

PF03828PAP_assoc227-248 aa

PF22600MTPAP-like_central269-292 aa

PF03828PAP_assoc298-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G032890	`PF22600`	MTPAP-like_central	36	156	9.4e-05	23.2
TkA04G032890	`PF01909`	NTP_transf_2	57	119	0.0035	18.4
TkA04G032890	`PF22812`	CR_prot_dom_plant	114	162	1.2	10.4
TkA04G032890	`PF26180`	PAP-OAS1	169	361	1.1e-84	283.8
TkA04G032890	`PF17406`	Nrap_D5	175	248	0.21	12.1
TkA04G032890	`PF03828`	PAP_assoc	227	248	0.0007	20.6
TkA04G032890	`PF22600`	MTPAP-like_central	269	292	9.4e-05	23.2
TkA04G032890	`PF03828`	PAP_assoc	298	313	0.0007	20.6
TkA04G032890	`PF22812`	CR_prot_dom_plant	524	533	1.2	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card