TkA04G032680 | RubberDandelionOmics

Gene overview

TkA04G032680

Reference: TK1151 Chr: Chr04 Coordinates: 8734468-8745190 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3441 bp · TkA04G032680|TK1151|cDNA

AGAGTCGCTTGAATCGTTTCCGCCACTTCCGAGTTACCAACATCGAATCGAACCGTGTCTTACTTTCGGTTCAAGCAGACGCCCTAGGGATAGACCCGATTGGCCGAATCCAAAGCACAAAGTAAACGCCTGAAGTCTGTACTCCCCTCAATGGCGGTCGGCGGTTGTACTTTCTCGTCGGACGATATCGTAGTGAAGTCGCCGAACGATAGGCGGTTATACAGATACATACAGCTCCCGAACGGCCTCTGTGCTTTGCT...

CDS

Download CDS FASTA

3084 bp · TkA04G032680|TK1151|CDS

ATGGCGGTCGGCGGTTGTACTTTCTCGTCGGACGATATCGTAGTGAAGTCGCCGAACGATAGGCGGTTATACAGATACATACAGCTCCCGAACGGCCTCTGTGCTTTGCTTGTGCATGATCCTGATATTTATAAGGACGGCACACCGGACAGCGCCAAACCTGAGGGAACGAGCGAGGATGATGACGATGAAGAAGACGACGAGGATGATGAGGAAGAAAGCGGAGATGAAGATGATGAAGGAGAAGACGACGACGAAGA...

Protein

Download Protein FASTA

1027 aa · TkA04G032680|TK1151|PROTEIN

MAVGGCTFSSDDIVVKSPNDRRLYRYIQLPNGLCALLVHDPDIYKDGTPDSAKPEGTSEDDDDEEDDEDDEEESGDEDDEGEDDDEEGESAKSNAPQTKKAAAAMCVGMGSFSDPLEAQGLAHFLEHMLFMGSAEFPDENEYDSYLSKHGGSSNAYTEVEHTCYHFEVKPEFLEGALRRFSQFFISPLVKTEAMDREVLAVDSEFNQALQSDACRLQQLQCHTAAPGHAFNQFFWGNKKSLSDAVEKGVNLRDQILKFYN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G032680`
TK1151 ID	TkA04G032680
OH-1004 ID	LXL04_036642
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G032680

Location Chr04:8734468-8745190 (+)

Description Similar to At1g06900: Nardilysin-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06900`	Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036642 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0010815 bradykinin catabolic process Biological Process

GO:0010992 ubiquitin recycling Biological Process

GO:0019885 antigen processing and presentation of endogenous peptide antigen via MHC class I Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0032092 positive regulation of protein binding Biological Process

GO:0032760 positive regulation of tumor necrosis factor production Biological Process

GO:0042447 hormone catabolic process Biological Process

GO:0043171 peptide catabolic process Biological Process

GO:0045732 positive regulation of protein catabolic process Biological Process

GO:0045861 negative regulation of proteolysis Biological Process

KEGG gene cross-reference

ath:AT1G06900

bta:523752

hsa:3416

hsa:4898

rno:25700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.584

Rank 1 · TkA04G032680 · TK1151

Nucleus0.414

Rank 2 · TkA04G032680 · TK1151

Mitochondrion0.085

Rank 3 · TkA04G032680 · TK1151

Cell membrane0.054

Rank 4 · TkA04G032680 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA04G032680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05132RNA_pol_Rpc426-100 aa

PF02724CDC4555-94 aa

PF09026CENP-B_dimeris56-105 aa

PF14851FAM17657-91 aa

PF04147Nop1457-94 aa

PF09073BUD2259-96 aa

PF00675Peptidase_M1693-226 aa

PF05193Peptidase_M16_C252-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G032680	`PF05132`	RNA_pol_Rpc4	26	100	0.076	14.0
TkA04G032680	`PF02724`	CDC45	55	94	8.4	5.3
TkA04G032680	`PF09026`	CENP-B_dimeris	56	105	0.061	14.5
TkA04G032680	`PF14851`	FAM176	57	91	0.47	11.0
TkA04G032680	`PF04147`	Nop14	57	94	4.5	6.1
TkA04G032680	`PF09073`	BUD22	59	96	0.36	10.8
TkA04G032680	`PF00675`	Peptidase_M16	93	226	6.7e-35	120.9
TkA04G032680	`PF05193`	Peptidase_M16_C	252	432	1e-41	143.5
TkA04G032680	`PF16187`	Peptidase_M16_M	439	728	1.9e-90	303.6
TkA04G032680	`PF05193`	Peptidase_M16_C	733	917	1e-41	143.5
TkA04G032680	`PF09026`	CENP-B_dimeris	770	810	0.061	14.5
TkA04G032680	`PF00675`	Peptidase_M16	834	858	6.7e-35	120.9
TkA04G032680	`PF22456`	PqqF-like_C_4	838	937	3.5e-26	92.0
TkA04G032680	`PF16187`	Peptidase_M16_M	885	927	1.9e-90	303.6
TkA04G032680	`PF14851`	FAM176	950	964	0.47	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HNU6`	Arabidopsis thaliana	sp\|F4HNU6\|NRDC_ARATH Nardilysin-like	68.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card