TkA04G031900 | RubberDandelionOmics

Gene overview

TkA04G031900

Reference: TK1151 Chr: Chr04 Coordinates: 8409499-8410278 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

750 bp · TkA04G031900|TK1151|cDNA

ATGGAGGTAAAGAGTGATTTGTCCGTACGATCGGCGGTGAAGTTCTCGGAGCATGTGGTGAGAACTAATAAGTTCGTTCAGGAGGAGCCGCCCTGGGACCATCTGGAGATGAAGCGGAGGGTGGTTAGGATCAGGCTGATGGATCCCTACGCCACTGATTCTTCTGGTGATGATGATGATGATGAAGGAGTGATGAAGAGAGTGAAGAAACACGTGTTTGAAATCAACGTTTACCCGCCATGTGCGAAATTCAAGAGGAG...

CDS

Download CDS FASTA

750 bp · TkA04G031900|TK1151|CDS

ATGGAGGTAAAGAGTGATTTGTCCGTACGATCGGCGGTGAAGTTCTCGGAGCATGTGGTGAGAACTAATAAGTTCGTTCAGGAGGAGCCGCCCTGGGACCATCTGGAGATGAAGCGGAGGGTGGTTAGGATCAGGCTGATGGATCCCTACGCCACTGATTCTTCTGGTGATGATGATGATGATGAAGGAGTGATGAAGAGAGTGAAGAAACACGTGTTTGAAATCAACGTTTACCCGCCATGTGCGAAATTCAAGAGGAG...

Protein

Download Protein FASTA

249 aa · TkA04G031900|TK1151|PROTEIN

MEVKSDLSVRSAVKFSEHVVRTNKFVQEEPPWDHLEMKRRVVRIRLMDPYATDSSGDDDDDEGVMKRVKKHVFEINVYPPCAKFKRRSTGSMEKKYRGVRRRPWGRWAAEIRDPSRRKRVWLGTFDTPEEAATVYDKAAVSLKGHNAVTNFPTVSVTETVVVEGKKPTVITTTGGDDDGLVHDAILSPTSVLPFDDELPPFAGLRYGDVDAFGFDIDLPINLPDFAAPAKYYAEEFGDFDIDDFLVDVR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G031900`
TK1151 ID	TkA04G031900
OH-1004 ID	LXL04_036654
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G031900

Location Chr04:8409499-8410278 (+)

Description Similar to PTI6: Pathogenesis-related genes transcriptional activator PTI6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46310`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release
`At4g11140`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release
`At4g27950`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release
`At3g61630`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036654 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0048364 root development Biological Process

GO:0048366 leaf development Biological Process

GO:0048825 cotyledon development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT2G46310

ath:AT4G11140

ath:AT4G23750

ath:AT4G27950

sly:544043

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · TkA04G031900 · TK1151

Cytoplasm0.080

Rank 2 · TkA04G031900 · TK1151

Cell membrane0.029

Rank 3 · TkA04G031900 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA04G031900 · TK1151

Plastid0.017

Rank 5 · TkA04G031900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP295-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G031900	`PF00847`	AP2	95	145	1.4e-15	58.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82339`	Arabidopsis thaliana	sp\|O82339\|CRF5_ARATH Ethylene-responsive transcription factor CRF5	46.000%	Swiss-Prot	Medium
`O82503`	Arabidopsis thaliana	sp\|O82503\|CRF1_ARATH Ethylene-responsive transcription factor CRF1	43.200%	Swiss-Prot	Medium
`Q9SUE3`	Arabidopsis thaliana	sp\|Q9SUE3\|CRF4_ARATH Ethylene-responsive transcription factor CRF4	42.000%	Swiss-Prot	Medium
`Q9M374`	Arabidopsis thaliana	sp\|Q9M374\|CRF6_ARATH Ethylene-responsive transcription factor CRF6	45.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card