RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G031580
Reference: TK1151 Chr: Chr04 Coordinates: 8320618-8326694 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3672 bp · TkA04G031580|TK1151|cDNA

TGTAGAAGTGTTAAATTTACACCTGAATATAGCAGCCTATTTAAATGCACTGGGTCCCATAATTCAACCAAAAGGAGTTAATCGAACACAAAAGTCAATGTTGGCGAATCCCATCTGGATTTCCGGATAGAAGAAGCAGAGCATTCACCCAACTTCTAATCGTTGTATTCTTACGTGTTTCTTATTATAAAATTGCAGTAAATTTCATAAACAATGGCCGATTACGTCACCACCTTCATCTGGCACCAGCTTACAATCGC...

CDS

Download CDS FASTA

2853 bp · TkA04G031580|TK1151|CDS

ATGTCCGAATTAAGAATTTTAGGGTTCATCACGTTCTTGGCTATCAGTTTGTTGCTTGCTGTTACAGATAGTCAATCTACTCATCCTACAGAAGTGACAGCACTACAGGTTATCAAGGAAAGCTTAATCGATTCAGACAATCGACTCAGTAACTGGGACCGCGGAGATCCATGTGTATCAAATTGGACCGGAGTCTTATGCTTCAATAGAACCCTAGACGACAGCTATCTTCATGTCAGAGAACTGCAACTATTGAATCT...

Protein

Download Protein FASTA

950 aa · TkA04G031580|TK1151|PROTEIN

MSELRILGFITFLAISLLLAVTDSQSTHPTEVTALQVIKESLIDSDNRLSNWDRGDPCVSNWTGVLCFNRTLDDSYLHVRELQLLNLKLEGTLSPAIGRLSFMQILDVMWNNISGSIPKEIGQLTNLELLLLNGNQLTGSLPEEIGYLPNLDRIQIDQNHISGSIPISFANLNKTKHFHMNNNSLSGQIPPELSRLPSIVHILLDNNNLSGYLPPQFSELPNLLILQLDNNHFEGSIPPSYGNMLKLLKLSLRNCSLQGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G031580
TK1151 IDTkA04G031580
OH-1004 IDLXL04_036657
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.300
Protein coverage (%)TK1151 99.053 / OH-1004 49.240
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G031580
LocationChr04:8320618-8326694 (-)
DescriptionSimilar to At1g06840: Probable LRR receptor-like serine/threonine-protein kinase At1g06840
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g06840 Probable LRR receptor-like serine/threonine-protein kinase At1g06840. No verified direct reference in this release
At5g37450 Probable LRR receptor-like serine/threonine-protein kinase At5g37450. No verified direct reference in this release
At3g53590 Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590. No verified direct reference in this release
At5g49770 Probable leucine-rich repeat receptor-like protein kinase At5g49770. No verified direct reference in this release
At5g49760 Leucine-rich repeat receptor protein kinase that acts as sensor of extracellular hydrogen peroxide.
Hydrogen peroxide sensor HPCA1 is an LRR receptor kinase in Arabidopsis.2020 · DOI: 10.1038/s41586-020-2032-3

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036657 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0045088 regulation of innate immune response Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G06840
ath:AT5G37450
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.854
Rank 1 · TkA04G031580 · TK1151
Cytoplasm0.078
Rank 2 · TkA04G031580 · TK1151
Endoplasmic reticulum0.074
Rank 3 · TkA04G031580 · TK1151
Nucleus0.041
Rank 4 · TkA04G031580 · TK1151
Lysosome / Vacuole0.035
Rank 5 · TkA04G031580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28230SCY_4732_6-21 aa
PF08263LRRNT_229-67 aa
PF25019LRR_R13L1-DRL2171-108 aa
PF23598LRR_1477-155 aa
PF00560LRR_179-100 aa
PF12799LRR_480-113 aa
PF13855LRR_896-137 aa
PF00560LRR_1104-124 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G031580PF28230SCY_4732_6210.3911.3
TkA04G031580PF08263LRRNT_229672.4e-1041.2
TkA04G031580PF25019LRR_R13L1-DRL21711080.2312.1
TkA04G031580PF23598LRR_14771553.8e-1039.8
TkA04G031580PF00560LRR_1791001e-2173.0
TkA04G031580PF12799LRR_4801137.6e-1245.8
TkA04G031580PF13855LRR_8961373.6e-1453.0
TkA04G031580PF00560LRR_11041241e-2173.0
TkA04G031580PF25019LRR_R13L1-DRL211161570.2312.1
TkA04G031580PF12799LRR_41251617.6e-1245.8
TkA04G031580PF00560LRR_11261481e-2173.0
TkA04G031580PF13855LRR_81492093.6e-1453.0
TkA04G031580PF00560LRR_11501721e-2173.0
TkA04G031580PF23598LRR_141712553.8e-1039.8
TkA04G031580PF00560LRR_11761961e-2173.0
TkA04G031580PF12799LRR_41762097.6e-1245.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGD7Arabidopsis thalianasp|C0LGD7|Y1684_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g0684065.700%Swiss-ProtHigh
C0LGU1Arabidopsis thalianasp|C0LGU1|Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g3745050.800%Swiss-ProtHigh
Q9LFG1Arabidopsis thalianasp|Q9LFG1|Y3359_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g5359052.700%Swiss-ProtHigh
Q9LT96Arabidopsis thalianasp|Q9LT96|Y5977_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g4977039.700%Swiss-ProtMedium
Q8GZ99Arabidopsis thalianasp|Q8GZ99|HPCA1_ARATH Leucine-rich repeat receptor protein kinase HPCA138.800%Swiss-ProtMedium

JBrowse

View in Genome Browser