TkA04G031230 | RubberDandelionOmics

Gene overview

TkA04G031230

Reference: TK1151 Chr: Chr04 Coordinates: 8227415-8228974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · TkA04G031230|TK1151|cDNA

ATGCTAGCTTGTATTCCGGCGACCACCACCGCCACCGGCCACCGTGGCTATGGTGGCAGTGGGTGGTGGTGTGCTCTTGGTGGTCTAAATCACTATCCATGGCTGTTGCATGTCCTATCTATAGTGTTTATCACTTTTCCGGCGACCTCCTCCGCCACCGGCCACCGTGGCAATGATGGCAGCGGATGGCAACATGCCAACATCACATTGTCATTTGAAATGTATCTGATCATGAAATTCTTTGTTCTTCTGATGATGCT...

CDS

Download CDS FASTA

1311 bp · TkA04G031230|TK1151|CDS

ATGCTAGCTTGTATTCCGGCGACCACCACCGCCACCGGCCACCGTGGCTATGGTGGCAGTGGGTGGTGGTGTGCTCTTGGTGGTCTAAATCACTATCCATGGCTGTTGCATGTCCTATCTATAGTGTTTATCACTTTTCCGGCGACCTCCTCCGCCACCGGCCACCGTGGCAATGATGGCAGCGGATGGCAACATGCCAACATCACATTGTCATTTGAAATGTATCTGATCATGAAATTCTTTGTTCTTCTGATGATGCT...

Protein

Download Protein FASTA

436 aa · TkA04G031230|TK1151|PROTEIN

MLACIPATTTATGHRGYGGSGWWCALGGLNHYPWLLHVLSIVFITFPATSSATGHRGNDGSGWQHANITLSFEMYLIMKFFVLLMMLMCVHVVQGSDHQPLFVEPSHVDTRILGYIMLALLTAYFAPTLIRRMYGNVGTTNKEQTETSALYNSRGLPVILQGLTNVYYRSGQFLGTGSMADTYAYVVHDTLTMTVKRLHWGYITDEKNFFIEQMDRVGRVVPFASNVIPLRGYIFSKAQKLLIYDMVEGSTLRSRLHGTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G031230`
TK1151 ID	TkA04G031230
OH-1004 ID	LXL04_035144
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	33.700
Protein coverage (%)	TK1151 61.468 / OH-1004 38.343 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G031230

Location Chr04:8227415-8228974 (-)

Description Similar to At5g58300: Probable inactive receptor kinase At5g58300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24100`	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At5g24100.	No verified direct reference in this release
`At3g02880`	Probable inactive receptor kinase At3g02880.	No verified direct reference in this release
`At5g53320`	Probable inactive receptor kinase At5g53320.	No verified direct reference in this release
`At5g16590`	Might be involved in early recognition of growth promoting fungi.	A leucine-rich repeat protein is required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03028.x
`At1g31420`	Involved in the signaling pathway that regulates cell wall function, including cellulose biosynthesis, likely via an 1- aminocyclopropane-1-carboxylic acid (ACC)-mediated signal (a precursor of ethylene).	Two leucine-rich repeat receptor kinases mediate signaling, linking cell wall biosynthesis and ACC synthase in Arabidopsis.2008 · DOI: 10.1105/tpc.108.063354

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035144 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:2000605 positive regulation of secondary growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0016328 lateral plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G26730

ath:AT3G08680

ath:AT4G23740

ath:AT5G05160

ath:AT5G58300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.755

Rank 1 · TkA04G031230 · TK1151

Endoplasmic reticulum0.130

Rank 2 · TkA04G031230 · TK1151

Cytoplasm0.110

Rank 3 · TkA04G031230 · TK1151

Nucleus0.079

Rank 4 · TkA04G031230 · TK1151

Lysosome / Vacuole0.049

Rank 5 · TkA04G031230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase168-427 aa

PF07714PK_Tyr_Ser-Thr173-430 aa

PF24476DUF7580264-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G031230	`PF00069`	Pkinase	168	427	3.7e-23	83.0
TkA04G031230	`PF07714`	PK_Tyr_Ser-Thr	173	430	4.1e-24	86.0
TkA04G031230	`PF24476`	DUF7580	264	372	0.045	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL63`	Arabidopsis thaliana	sp\|Q9FL63\|Y5410_ARATH Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At5g24100	34.500%	Swiss-Prot	Medium
`Q9M8T0`	Arabidopsis thaliana	sp\|Q9M8T0\|Y3288_ARATH Probable inactive receptor kinase At3g02880	30.400%	Swiss-Prot	Medium
`Q9FK10`	Arabidopsis thaliana	sp\|Q9FK10\|Y5332_ARATH Probable inactive receptor kinase At5g53320	30.500%	Swiss-Prot	Medium
`Q9FMD7`	Arabidopsis thaliana	sp\|Q9FMD7\|Y5659_ARATH Probable inactive receptor kinase At5g16590	29.700%	Swiss-Prot	Low
`C0LGF4`	Arabidopsis thaliana	sp\|C0LGF4\|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1	28.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card