TkA04G030800 | RubberDandelionOmics

Gene overview

TkA04G030800

Reference: TK1151 Chr: Chr04 Coordinates: 8139884-8141424 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · TkA04G030800|TK1151|cDNA

CTAGAAGCCGGACGCACTATAAATTAAACCCGCTGTAATTTTCATCCAAACCCTAGTTTCGTTTCCCCATTCCTGTTCGGATCTGCTCCTGGTTCTGAATTTGCTCCTCAATTTCAATAACCAACCGAGTTCAAAATTTTGATTAGGTTTGCTTCGATATACCTTCGACGAGGGCTTGTTTAGACGGAGCTGATTTGTGGTTGGTACTATCGCGATTTGCTTTTACGTTTACGAGCGAGTACAGCTCTGAGATCGTAAGC...

CDS

Download CDS FASTA

447 bp · TkA04G030800|TK1151|CDS

ATGGCGTCGAAGCGTATCTTGAAGGAACTCAAGGATTTGCAGAAGGATCCCCCTACGTCATGCAGCGCAGGGCCAGTAGCAGAGGACATGTTCCATTGGCAAGCAACAATCATGGGCCCCAATGATAGCCCATACTCCGGTGGTGTGTTCTTGGTCTCAATTCATTTCCCACCTGACTACCCTTTCAAACCACCCAAGGTTGCATTCAGGACAAAGGTCTTCCACCCAAACATCAATAGCAATGGTAGCATTTGCTTAGA...

Protein

Download Protein FASTA

148 aa · TkA04G030800|TK1151|PROTEIN

MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPNDSPYSGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKSKYEATARSWTQKYAMG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G030800`
TK1151 ID	TkA04G030800
OH-1004 ID	LXL04_005796
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G030800

Location Chr04:8139884-8141424 (+)

Description Similar to UBC10: Ubiquitin-conjugating enzyme E2 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27960`	Accepts the ubiquitin-like protein SUMO/SMT3 from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At1g64230`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At5g53300`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At5g41700`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	Genome analysis and functional characterization of the E2 and RING-type E3 ligase ubiquitination enzymes of Arabidopsis.2005 · DOI: 10.1104/pp.105.067983

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005796 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

GO:0061631 ubiquitin conjugating enzyme activity Molecular Function

KEGG gene cross-reference

ath:AT1G64230

ath:AT4G27960

ath:AT5G53300

dosa:Os02g0261100

sly:100301932

sly:101249087

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.588

Rank 1 · TkA04G030800 · TK1151

Cytoplasm0.572

Rank 2 · TkA04G030800 · TK1151

Cell membrane0.083

Rank 3 · TkA04G030800 · TK1151

Mitochondrion0.074

Rank 4 · TkA04G030800 · TK1151

Endoplasmic reticulum0.069

Rank 5 · TkA04G030800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179UQ_con5-141 aa

PF05773RWD50-109 aa

PF05743UEV52-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G030800	`PF00179`	UQ_con	5	141	1e-54	184.7
TkA04G030800	`PF05773`	RWD	50	109	0.0016	19.3
TkA04G030800	`PF05743`	UEV	52	115	0.065	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P35132`	Arabidopsis thaliana	sp\|P35132\|UBC9_ARATH SUMO-conjugating enzyme UBC9	96.600%	Swiss-Prot	High
`Q94F47`	Arabidopsis thaliana	sp\|Q94F47\|UBC28_ARATH Ubiquitin-conjugating enzyme E2 28	95.900%	Swiss-Prot	High
`P35133`	Arabidopsis thaliana	sp\|P35133\|UBC10_ARATH Ubiquitin-conjugating enzyme E2 10	95.900%	Swiss-Prot	High
`P35131`	Arabidopsis thaliana	sp\|P35131\|UBC8_ARATH Ubiquitin-conjugating enzyme E2 8	95.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card