TkA04G030370 | RubberDandelionOmics

Gene overview

TkA04G030370

Reference: TK1151 Chr: Chr04 Coordinates: 8025986-8028426 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1954 bp · TkA04G030370|TK1151|cDNA

CGCCGTTAACCCTTATTTATATTCGCTTTCATGATTACTTATATTTTTCAGCCTTCAAGGGAACCCCGGATGCTCAAATGCCAGCTTGGCACAGTTCTGTAAATCATCTACATCAGTCATCCACCTACAGAGCATTCCATCAAACTCGAATGTAAATTGCCCACCTGAATCGTGCCCAAATCACTTCGAATATGCTCCAGGGTCACCAGTACGATGCTTCTGTGCCGCACCACTTCTTGTTGGGTTTCGGTTAAAGAGTC...

CDS

Download CDS FASTA

1392 bp · TkA04G030370|TK1151|CDS

ATGTATTTGAAGCTTTTTCCGGTTTATACTGTACCTGGTTCTAATGTCTTCAATAAAAGTGAAGTGCTCCGGATTCGAAACATGTTCTTGGACTGGGAGATTCCATATAACAAATTGTATGGACCTTACGAGCTTATCAATTTCACACTACCGGATCCGTATAAAAATTACTTCCCGATCGGATCACCTACTTCTGGTATAAGCAAGGGTGCGGTGGCAGGCACCATCGTAGGGGCAATTATAGGTGCGGTTTTAGTTAC...

Protein

Download Protein FASTA

463 aa · TkA04G030370|TK1151|PROTEIN

MYLKLFPVYTVPGSNVFNKSEVLRIRNMFLDWEIPYNKLYGPYELINFTLPDPYKNYFPIGSPTSGISKGAVAGTIVGAIIGAVLVTAFVSLYILRSRRKKFNAVARRRRVSRASLKIEGVKSFTIEEMKQATNNFDVASEVGHGGYGKVYKGVFTDGTIVAIKRAQEGSLQGENEFLTEIQLLSRLHHRNLVYLLGFCDEEGEQMLVYEFMSNGTLRDHLSGNSKESLSFAMRLRIALDSAKGILYLHTEANPPIFHRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G030370`
TK1151 ID	TkA04G030370
OH-1004 ID	LXL04_036657
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.400
Protein coverage (%)	TK1151 100.000 / OH-1004 23.912 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G030370

Location Chr04:8025986-8028426 (-)

Description Similar to At1g06840: Probable LRR receptor-like serine/threonine-protein kinase At1g06840

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06840`	Probable LRR receptor-like serine/threonine-protein kinase At1g06840.	No verified direct reference in this release
`At5g37450`	Probable LRR receptor-like serine/threonine-protein kinase At5g37450.	No verified direct reference in this release
`At3g53590`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590.	No verified direct reference in this release
`At5g49760`	Leucine-rich repeat receptor protein kinase that acts as sensor of extracellular hydrogen peroxide.	Hydrogen peroxide sensor HPCA1 is an LRR receptor kinase in Arabidopsis.2020 · DOI: 10.1038/s41586-020-2032-3
`At5g49770`	Probable leucine-rich repeat receptor-like protein kinase At5g49770.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036657 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045088 regulation of innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06840

ath:AT5G37450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.817

Rank 1 · TkA04G030370 · TK1151

Cytoplasm0.120

Rank 2 · TkA04G030370 · TK1151

Endoplasmic reticulum0.076

Rank 3 · TkA04G030370 · TK1151

Nucleus0.075

Rank 4 · TkA04G030370 · TK1151

Golgi apparatus0.033

Rank 5 · TkA04G030370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13488Gly-zipper_Omp60-84 aa

PF05433Rick_17kDa_Anti61-85 aa

PF27527Y2009_N65-87 aa

PF06406StbA_N84-130 aa

PF00069Pkinase137-403 aa

PF07714PK_Tyr_Ser-Thr139-405 aa

PF03109ABC1144-168 aa

PF06406StbA_N203-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G030370	`PF13488`	Gly-zipper_Omp	60	84	0.15	12.7
TkA04G030370	`PF05433`	Rick_17kDa_Anti	61	85	0.077	13.6
TkA04G030370	`PF27527`	Y2009_N	65	87	0.61	10.6
TkA04G030370	`PF06406`	StbA_N	84	130	0.2	12.3
TkA04G030370	`PF00069`	Pkinase	137	403	1.4e-46	159.8
TkA04G030370	`PF07714`	PK_Tyr_Ser-Thr	139	405	4.3e-46	158.0
TkA04G030370	`PF03109`	ABC1	144	168	0.07	13.0
TkA04G030370	`PF06406`	StbA_N	203	227	0.2	12.3
TkA04G030370	`PF03109`	ABC1	205	283	0.07	13.0
TkA04G030370	`PF06406`	StbA_N	346	413	0.2	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGD7`	Arabidopsis thaliana	sp\|C0LGD7\|Y1684_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g06840	66.700%	Swiss-Prot	High
`C0LGU1`	Arabidopsis thaliana	sp\|C0LGU1\|Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450	48.600%	Swiss-Prot	Medium
`Q9LFG1`	Arabidopsis thaliana	sp\|Q9LFG1\|Y3359_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590	48.600%	Swiss-Prot	Medium
`Q8GZ99`	Arabidopsis thaliana	sp\|Q8GZ99\|HPCA1_ARATH Leucine-rich repeat receptor protein kinase HPCA1	44.200%	Swiss-Prot	Medium
`Q9LT96`	Arabidopsis thaliana	sp\|Q9LT96\|Y5977_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g49770	43.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card