TkA04G029270 | RubberDandelionOmics

Gene overview

TkA04G029270

Reference: TK1151 Chr: Chr04 Coordinates: 7710181-7712008 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

867 bp · TkA04G029270|TK1151|cDNA

GCGATACAAAAAGCAATCCCAGCCGTCGATCTCAGTTCTTTTTAGGCATTAGGGTTTTTCATATCCGGACGCCTTAATTCTCCTTCACTGAACCTGTAAACCTCTCTTTCCTCCCCCCGGCGCCGCTCTCAGACACACGAAAAATCAGCCATGGTTTTCGTCGCACAGAAGTCTAGATCTTACTTCAAGAGGTTTCAAGTCAAATTCAAGCGAAGGAGAGAGGGCAAGACTGATTACCGTGCACGGATTCGTCTTATTAA...

CDS

Download CDS FASTA

405 bp · TkA04G029270|TK1151|CDS

ATGGTTCTTGCATCAGCTTATGCTCATGAACTCCCTGGCTACGGCCTCAAAGTTGGACTTACAAACTATGCTGCAGCTTACTGCACCGGACTTCTGTTGGCTCGCCGTGTTTTGAAAGCACTTGAAATGGATGAGGAGTATGAGGGAAATGTTGAGGCAACTGGTGAAGACTACTCAGTGGAACCTGCAGAAAGCAGGAGGCCATTCCGTGCACTTTTGGATGTTGGTCTTCTTCGCACAACAACTGGCAACCGTGTTTT...

Protein

Download Protein FASTA

134 aa · TkA04G029270|TK1151|PROTEIN

MVLASAYAHELPGYGLKVGLTNYAAAYCTGLLLARRVLKALEMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFAGYNKDGKQIFYFLQIWSLILRFIVQF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G029270`
TK1151 ID	TkA04G029270
OH-1004 ID	LXL04_019072
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.900
Protein coverage (%)	TK1151 87.313 / OH-1004 33.621 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G029270

Location Chr04:7710181-7712008 (-)

Description Similar to RPL5: 60S ribosomal protein L5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25520`	Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.	Three PIGGYBACK genes that specifically influence leaf patterning encode ribosomal proteins.2008 · DOI: 10.1242/dev.016469 Coordination of cell proliferation and cell expansion mediated by ribosome-related processes in the leaves of Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03886.x
`At5g39740`	Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.	Coordination of cell proliferation and cell expansion mediated by ribosome-related processes in the leaves of Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03886.x

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WXX3`	Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.	No verified direct reference in this release
`Os01g0896800`	Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019072 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0006412 translation Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0009955 adaxial/abaxial pattern specification Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0051301 cell division Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G25520

ath:AT5G39740

csv:101216379

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.477

Rank 1 · TkA04G029270 · TK1151

Nucleus0.231

Rank 2 · TkA04G029270 · TK1151

Mitochondrion0.167

Rank 3 · TkA04G029270 · TK1151

Peroxisome0.106

Rank 4 · TkA04G029270 · TK1151

Plastid0.106

Rank 5 · TkA04G029270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17144Ribosomal_L5e1-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G029270	`PF17144`	Ribosomal_L5e	1	103	1.1e-44	153.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBI1`	Arabidopsis thaliana	sp\|Q8LBI1\|RL51_ARATH Large ribosomal subunit protein uL18z	85.500%	Swiss-Prot	High
`P49227`	Arabidopsis thaliana	sp\|P49227\|RL52_ARATH Large ribosomal subunit protein uL18y	85.500%	Swiss-Prot	High
`A2WXX3`	Oryza sativa subsp. indica	sp\|A2WXX3\|RL51_ORYSI Large ribosomal subunit protein uL18	81.200%	Swiss-Prot	High
`Q0JGY1`	Oryza sativa subsp. japonica	sp\|Q0JGY1\|RL51_ORYSJ Large ribosomal subunit protein uL18z	81.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card