TkA04G028620 | RubberDandelionOmics

Gene overview

TkA04G028620

Reference: TK1151 Chr: Chr04 Coordinates: 7542214-7543791 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

696 bp · TkA04G028620|TK1151|cDNA

ATGGCGACATATATGAAGTCGGATGGTGTACAGGTTAGTCGTTTCTCCAAAGAGAATTTGATTTGGCTGGAGCCTCATAAAAAGCAAGAGTTGGTTCATCCCAACCATCAGAAACCTCATTCAAGCGCAAACGTGGAGTTTTTCAGAAAGATCCATATGATGTATGGATTCAGAGATGATCCTAATCCATTACCAGAGACTGTTGCTCTTGTGGAAGACATTTTTGTTGAGTATGTGACAGATATGGTGCATAAAGCCCA...

CDS

Download CDS FASTA

432 bp · TkA04G028620|TK1151|CDS

ATGGCGACATATATGAAGTCGGATGGTGTACAGGTTAGTCGTTTCTCCAAAGAGAATTTGATTTGGCTGGAGCCTCATAAAAAGCAAGAGTTGGTTCATCCCAACCATCAGAAACCTCATTCAAGCGCAAACGTGGAGTTTTTCAGAAAGATCCATATGATGTATGGATTCAGAGATGATCCTAATCCATTACCAGAGACTGTTGCTCTTGTGGAAGACATTTTTGTTGAGTATGTGACAGATATGGTGCATAAAGCCCA...

Protein

Download Protein FASTA

143 aa · TkA04G028620|TK1151|PROTEIN

MATYMKSDGVQVSRFSKENLIWLEPHKKQELVHPNHQKPHSSANVEFFRKIHMMYGFRDDPNPLPETVALVEDIFVEYVTDMVHKAQDIASKRGKLLTEDFLFLICKDTPKLIRCTELLSMNEELKQARIAFDVDEEKLATVD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G028620`
TK1151 ID	TkA04G028620
OH-1004 ID	LXL04_036705
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G028620

Location Chr04:7542214-7543791 (-)

Description Similar to TAF13: Transcription initiation factor TFIID subunit 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02680`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	TAF13 interacts with PRC2 members and is essential for Arabidopsis seed development.2013 · DOI: 10.1016/j.ydbio.2013.03.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036705 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006352 DNA-templated transcription initiation Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009960 endosperm development Biological Process

GO:0042789 mRNA transcription by RNA polymerase II Biological Process

GO:0048316 seed development Biological Process

GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process

GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005669 transcription factor TFIID complex Cellular Component

KEGG gene cross-reference

ath:AT1G02680

bta:513065

hsa:6884

mmu:99730

pon:100172778

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.752

Rank 1 · TkA04G028620 · TK1151

Cytoplasm0.284

Rank 2 · TkA04G028620 · TK1151

Mitochondrion0.039

Rank 3 · TkA04G028620 · TK1151

Cell membrane0.026

Rank 4 · TkA04G028620 · TK1151

Endoplasmic reticulum0.024

Rank 5 · TkA04G028620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02269TFIID-18kDa52-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G028620	`PF02269`	TFIID-18kDa	52	133	1.7e-22	79.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQH4`	Arabidopsis thaliana	sp\|Q6NQH4\|TAF13_ARATH Transcription initiation factor TFIID subunit 13	66.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card