TkA04G028310 | RubberDandelionOmics

Gene overview

TkA04G028310

Reference: TK1151 Chr: Chr04 Coordinates: 7473906-7481175 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1761 bp · TkA04G028310|TK1151|cDNA

AAAAGACAGAGACAACTATCGTGCCCATACTATGAATATAACCCCAAAAATAATACATCAAAAAATAAAAATCAATTTTTTAATCTTTTATATCTTCTTATCGTCGTTTCTTCATTCTTCCTCCCCCCTCCACCATCTTCGCCGGTAAAACCCAATTCACCCACCGGCGAGAAGCCTCCGCCACAGTTACTCTCAACCTCTCACAAATGGCGTCGTCAATCCCCTACCTTCTAGTATCGCCGCCGCTCAATTACCACACA...

CDS

Download CDS FASTA

1212 bp · TkA04G028310|TK1151|CDS

ATGGCGTCGTCAATCCCCTACCTTCTAGTATCGCCGCCGCTCAATTACCACACAACCACTTCAATTCACAAACCCCTCGTCTTCTTCCCCAATCCCACAAACTCCCTCTCGTTAAAATCAATCAATCAAAGCCCCCGTTTTTCTTCTCCCGCAAGAAGAAAATCGTCTTCTATCGGTGCCGGTGCGTCAGCGGCAACCGCGTGCTCCACGTCGTACCCTTTCATCGGTAAAGTCGGGTTGCATAGAAGAGAAGGTAACTT...

Protein

Download Protein FASTA

403 aa · TkA04G028310|TK1151|PROTEIN

MASSIPYLLVSPPLNYHTTTSIHKPLVFFPNPTNSLSLKSINQSPRFSSPARRKSSSIGAGASAATACSTSYPFIGKVGLHRREGNFILLSYGTNPNTGSTMAVKADVSQILSAMLPFVVALTAIAALTQPLTFTWVSKELYAPALGGIMLSIGIKLSIEDFALAFKRPVPLSIGFLAQYVLKPVLGVFIAKSFGMSPMYYAGFVLMSCVAGAQLSSYASFLSKGDVALSILLTSSSTIASVVITPLLTGLLIGSVVPVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G028310`
TK1151 ID	TkA04G028310
OH-1004 ID	LXL04_036710
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G028310

Location Chr04:7473906-7481175 (-)

Description Similar to BASS3: Probable sodium/metabolite cotransporter BASS3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25410`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release
`At2g26900`	Sodium-coupled metabolite transporter that plays a crucial role in pyruvate transport across the chloroplast envelope.	A plastidial sodium-dependent pyruvate transporter.2011 · DOI: 10.1038/nature10250
`At4g22840`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0475400`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release
`Os01g0645200`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release
`UniProt: B8BDK4`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036710 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006849 plasma membrane pyruvate transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0015293 symporter activity Molecular Function

GO:0050833 pyruvate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G26900

ath:AT3G25410

dosa:Os01g0645200

dosa:Os02g0475400

dosa:Os09g0520600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · TkA04G028310 · TK1151

Mitochondrion0.017

Rank 2 · TkA04G028310 · TK1151

Nucleus0.017

Rank 3 · TkA04G028310 · TK1151

Cell membrane0.015

Rank 4 · TkA04G028310 · TK1151

Peroxisome0.015

Rank 5 · TkA04G028310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01758SBF115-135 aa

PF13593SBF_like117-278 aa

PF01758SBF144-274 aa

PF09527ATPase_gene1186-212 aa

PF09527ATPase_gene1237-260 aa

PF01758SBF345-377 aa

PF09527ATPase_gene1366-382 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G028310	`PF01758`	SBF	115	135	2e-27	96.8
TkA04G028310	`PF13593`	SBF_like	117	278	2.3e-05	24.6
TkA04G028310	`PF01758`	SBF	144	274	2e-27	96.8
TkA04G028310	`PF09527`	ATPase_gene1	186	212	7.5	7.4
TkA04G028310	`PF09527`	ATPase_gene1	237	260	7.5	7.4
TkA04G028310	`PF01758`	SBF	345	377	2e-27	96.8
TkA04G028310	`PF09527`	ATPase_gene1	366	382	7.5	7.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXE8`	Arabidopsis thaliana	sp\|Q8RXE8\|BASS3_ARATH Probable sodium/metabolite cotransporter BASS3, chloroplastic	67.100%	Swiss-Prot	High
`Q1EBV7`	Arabidopsis thaliana	sp\|Q1EBV7\|BASS2_ARATH Sodium/pyruvate cotransporter BASS2, chloroplastic	39.500%	Swiss-Prot	Medium
`Q8VYY4`	Arabidopsis thaliana	sp\|Q8VYY4\|BASS6_ARATH Probable sodium/metabolite cotransporter BASS6, chloroplastic	39.600%	Swiss-Prot	Medium
`Q6K739`	Oryza sativa subsp. japonica	sp\|Q6K739\|BASS3_ORYSJ Probable sodium/metabolite cotransporter BASS3, chloroplastic	63.400%	Swiss-Prot	High
`Q5VRB2`	Oryza sativa subsp. japonica	sp\|Q5VRB2\|BASS2_ORYSJ Probable sodium/metabolite cotransporter BASS2, chloroplastic	40.300%	Swiss-Prot	Medium
`B8BDK4`	Oryza sativa subsp. indica	sp\|B8BDK4\|BASS5_ORYSI Probable sodium/metabolite cotransporter BASS5, chloroplastic	37.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card