TkA04G024430 | RubberDandelionOmics

Gene overview

TkA04G024430

Reference: TK1151 Chr: Chr04 Coordinates: 6330522-6335120 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3170 bp · TkA04G024430|TK1151|cDNA

TGAGAAGAACCAAACAAAGATGCAAAGGATTTTTGAACTTATCTCCTTCCCAGTTTCATAAAACATTCATATTTCAAATAGCTCCTCACATACCAACCATTTTGCTTCATCTAATCGATCTCCGGTGGGTTCTCCATTTTTTCCGTTGACCTCTGTTCTTCCAGTGGTTCGGTTTTTCCCCTCATTATTTAGTCTATGCAAATCCAAACTGACTTCTGGTGTTAGATTTGGGTTTTTTTTTTCTGGGGTTTGGTTATGGT...

CDS

Download CDS FASTA

2295 bp · TkA04G024430|TK1151|CDS

ATGTATCCGAAGCAAGAAAAAGTCGATGTTATGGAAATTTGTGGTGTCGATGAGCAAGAAAATCATAAAAGTACTGGTTTTGATGCACCAGGTACTACTGTGATGACGAGCACCGATGATCAGAGAGGGATCTGGGAGATTGATGTAAGAGCTCAACAACAAAATCTGCTTCACGAAATGAACGATCCTTCAATGTTTTACAACGATCAGTTTCCTCAGATTCCTGATTTTCCATGCATGTCTTCTTCATCGTCTTCTTC...

Protein

Download Protein FASTA

764 aa · TkA04G024430|TK1151|PROTEIN

MYPKQEKVDVMEICGVDEQENHKSTGFDAPGTTVMTSTDDQRGIWEIDVRAQQQNLLHEMNDPSMFYNDQFPQIPDFPCMSSSSSSSSNPAPAKPISSATTTSSASSGSSSTSSAASWAVLKSEYVTEEEAEGEDHLEELRINRRKRSNREEPVPVMSTAAAVEAVPVLDKADGSGTIDCMDVMENFGYMDLIDGNEIWDPSSIFEQNPPDLQQECVTATCGYSNGSEVLQESETKDGGREGGGGRLDELGVMFFDWLKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G024430`
TK1151 ID	TkA04G024430
OH-1004 ID	LXL04_036796
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G024430

Location Chr04:6330522-6335120 (+)

Description Similar to ABI3: B3 domain-containing transcription factor ABI3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24650`	Participates in abscisic acid-regulated gene expression during seed development.	A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968 ABI3 controls embryo degreening through Mendel's I locus.2013 · DOI: 10.1073/pnas.1308114110
`At3g26790`	Transcription regulator involved in gene regulation during late embryogenesis.	The FUS3 transcription factor functions through the epidermal regulator TTG1 during embryogenesis in Arabidopsis.2004 · DOI: 10.1046/j.1365-313x.2003.01939.x The transcription factor FUSCA3 controls developmental timing in Arabidopsis through the hormones gibberellin and abscisic acid.2004 · DOI: 10.1016/j.devcel.2004.06.017 AKIN10 and FUSCA3 interact to control lateral organ development and phase transitions in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04832.x Overlapping and distinct roles of AKIN10 and FUSCA3 in ABA and sugar signaling during seed germination.2012 · DOI: 10.4161/psb.21549

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0911700`	Probable transcription factor that may participate in abscisic acid-regulated gene expression during seed development.	No verified direct reference in this release
`UniProt: Q7XKC4`	Putative B3 domain-containing protein Os04g0676650.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036796 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009657 plastid organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010116 positive regulation of abscisic acid biosynthetic process Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010262 somatic embryogenesis Biological Process

KEGG gene cross-reference

ath:AT3G24650

ath:AT3G26790

dosa:Os04g0676600

zma:542523

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980

Rank 1 · TkA04G024430 · TK1151

Cytoplasm0.070

Rank 2 · TkA04G024430 · TK1151

Cell membrane0.032

Rank 3 · TkA04G024430 · TK1151

Endoplasmic reticulum0.026

Rank 4 · TkA04G024430 · TK1151

Plastid0.012

Rank 5 · TkA04G024430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B3623-719 aa

PF31239At5g26805_C623-712 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G024430	`PF02362`	B3	623	719	3.5e-17	62.9
TkA04G024430	`PF31239`	At5g26805_C	623	712	0.0007	20.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q01593`	Arabidopsis thaliana	sp\|Q01593\|ABI3_ARATH B3 domain-containing transcription factor ABI3	43.800%	Swiss-Prot	Medium
`Q9LW31`	Arabidopsis thaliana	sp\|Q9LW31\|FUS3_ARATH B3 domain-containing transcription factor FUS3	56.400%	Swiss-Prot	Low
`P37398`	Oryza sativa subsp. japonica	sp\|P37398\|VIV_ORYSJ B3 domain-containing protein VP1	38.100%	Swiss-Prot	Medium
`Q7XKC4`	Oryza sativa subsp. japonica	sp\|Q7XKC4\|Y4765_ORYSJ Putative B3 domain-containing protein Os04g0676650	51.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card