TkA04G022250 | RubberDandelionOmics

Gene overview

TkA04G022250

Reference: TK1151 Chr: Chr04 Coordinates: 5646465-5652609 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1358 bp · TkA04G022250|TK1151|cDNA

CCTTATCTTCTTCTTTCCTCTTCAAAAATGTCGACACACACAAAAGGGGACCCCTTCCCCTCCCTTGAAAACAGTCGGCCTCTCCTTCCCTACTCCCCATGTCTTCCTTGCTTTCCATGCACACACAAGGTCAACGCTAATCACCTCACTTCCTCTCCTTGATCGCAATTCACCCTTCGAAGGCGGCCCTCCCTCCTTCTTCTTCTTCTTCTTCTCGTCGAACCAACCCCCAACACCCATCATTCCATAACAAATATCTC...

CDS

Download CDS FASTA

423 bp · TkA04G022250|TK1151|CDS

ATGTCGAAGCGAGGTCGTGGAGGTTCCGCCGGGAACAAGTTTCGGATGTCGCTAGGTCTTCCAGTGGCCGCGACGATCAACTGTGCCGACAACACCGGCGCTAAGAACCTTTACATCATATCAGTTAAGGGGATCAAGGGACGTCTTAACCGTCTTCCTTCGGCTTGCGTCGGAGACATGGTTATGGCTACTGTGAAGAAGGGGAAGCCAGATCTGAGGAAGAAGGTTATGCCGGCTGTTGTTGTTCGTCAGCGTAAGCC...

Protein

Download Protein FASTA

140 aa · TkA04G022250|TK1151|PROTEIN

MSKRGRGGSAGNKFRMSLGLPVAATINCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVVVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASAANAIV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G022250`
TK1151 ID	TkA04G022250
OH-1004 ID	LXL04_036826
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G022250

Location Chr04:5646465-5652609 (-)

Description Similar to RPL23: 60S ribosomal protein L23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P49690`	Large ribosomal subunit protein uL14x/uL14z/uL14y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036826 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0032986 protein-DNA complex disassembly Biological Process

GO:0050821 protein stabilization Biological Process

GO:0070314 G1 to G0 transition Biological Process

GO:1903450 regulation of G1 to G0 transition Biological Process

GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT1G04480

ath:AT2G33370

ath:AT3G04400

dre:336812

rno:29282

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.717

Rank 1 · TkA04G022250 · TK1151

Nucleus0.138

Rank 2 · TkA04G022250 · TK1151

Mitochondrion0.098

Rank 3 · TkA04G022250 · TK1151

Endoplasmic reticulum0.073

Rank 4 · TkA04G022250 · TK1151

Plastid0.066

Rank 5 · TkA04G022250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00238Ribosomal_L1421-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G022250	`PF00238`	Ribosomal_L14	21	140	7.1e-42	142.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49690`	Arabidopsis thaliana	sp\|P49690\|RL23_ARATH Large ribosomal subunit protein uL14x/uL14z/uL14y	96.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card