TkA04G020480 | RubberDandelionOmics

Gene overview

TkA04G020480

Reference: TK1151 Chr: Chr04 Coordinates: 5189419-5191244 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1623 bp · TkA04G020480|TK1151|cDNA

TTACATTAAGTACAGTTAATATATCATTTGAAACAGTTAAATTTTGTTAATCCGTTTTAATGAGCGGTCCAAGGGCCTGCCGGAGTTCCGGTCCGGGCACTCTTATCTATGAAAAACCACACGGAGTTGACAATTCAAACCTCAAACACACGTCTCTCCTACTTACTCTCACTCTGATTATAATATACCATCTTCCTTTCTCCATCTTCCATTCTTTAATCCTACGTTCTGATAGATTCACTTCCAAAATCAATCCCGAT...

CDS

Download CDS FASTA

882 bp · TkA04G020480|TK1151|CDS

ATGTCGTTCGAGTTAGAAGAAGAAGAATCGTTCGAGCACACGTTACTTGTGGTTCGAGAAGTGTCTGTATTCAAAATCCCGCCGCGGTCCACTAGCGGCGGTTACAAGTGCGGAGAATGGCTTCAGTCGGACAAGATCTGGTCTGGTAGGCTTCGTGTTGTTTCGTGTAAGGACCGGTGTGAGATCCGGTTGGAAGATCCGAATTCTGGTGATTTGTTTGCGGCGTGTTTTGTTTATCCTGGTCAGAGGGAGAACGCGGT...

Protein

Download Protein FASTA

293 aa · TkA04G020480|TK1151|PROTEIN

MSFELEEEESFEHTLLVVREVSVFKIPPRSTSGGYKCGEWLQSDKIWSGRLRVVSCKDRCEIRLEDPNSGDLFAACFVYPGQRENAVESVLDSSRYFVLKIEDGTGKHAFIGLGFTERNEAFDFNVALSDHDKYVKREIEKDADEASDDSHINIHPAVNHRLKEGETIRITVKNKPASGAGMLSSAGLSGTEKIKPLSLAPPPVNVKKPLSLAPPPTTAGKIRSPIPPPPNDPAAIRMTSSSTSHNVPSRHSTDAFTDFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G020480`
TK1151 ID	TkA04G020480
OH-1004 ID	LXL04_020067
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	44.700
Protein coverage (%)	TK1151 56.997 / OH-1004 55.932 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G020480

Location Chr04:5189419-5191244 (+)

Description Similar to Necap2: Adaptin ear-binding coat-associated protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03900`	Uncharacterized protein At1g03900.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020067 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0005905 clathrin-coated pit Cellular Component

GO:0030125 clathrin vesicle coat Cellular Component

KEGG gene cross-reference

bta:504449

bta:509439

hsa:55707

mmu:66147

rno:298598

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.656

Rank 1 · TkA04G020480 · TK1151

Nucleus0.253

Rank 2 · TkA04G020480 · TK1151

Cell membrane0.248

Rank 3 · TkA04G020480 · TK1151

Golgi apparatus0.095

Rank 4 · TkA04G020480 · TK1151

Lysosome / Vacuole0.068

Rank 5 · TkA04G020480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07933DUF168111-172 aa

PF24547DUF7601116-171 aa

PF04360Serglycin250-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G020480	`PF07933`	DUF1681	11	172	1.8e-57	194.2
TkA04G020480	`PF24547`	DUF7601	116	171	0.1	13.9
TkA04G020480	`PF04360`	Serglycin	250	282	0.039	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q681Q7`	Arabidopsis thaliana	sp\|Q681Q7\|Y1390_ARATH Uncharacterized protein At1g03900	65.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card