TkA04G019440 | RubberDandelionOmics

Gene overview

TkA04G019440

Reference: TK1151 Chr: Chr04 Coordinates: 4851806-4852315 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · TkA04G019440|TK1151|cDNA

ATGACGTGGATTTCACCATTGAATTCCTTTGGTGCAAAAGAACTTCACTCTATCGAAACTGTATTCAACACCCACCCACATGGGTGTCTGCTAATCCTTTCAAACACCATGGATTCGAATAAAGGACGCGAGATTTTAAAACCTTTTACCGAAAAAGGGTTTCGAGTAACAGCAATTTCGCCTGATTTACACTACTTGTTCAAGAACACAATGGCAGACTCATGGTTTTTTAAGTTAACCAGAGGTGATCTCGACGCTGG...

CDS

Download CDS FASTA

510 bp · TkA04G019440|TK1151|CDS

ATGACGTGGATTTCACCATTGAATTCCTTTGGTGCAAAAGAACTTCACTCTATCGAAACTGTATTCAACACCCACCCACATGGGTGTCTGCTAATCCTTTCAAACACCATGGATTCGAATAAAGGACGCGAGATTTTAAAACCTTTTACCGAAAAAGGGTTTCGAGTAACAGCAATTTCGCCTGATTTACACTACTTGTTCAAGAACACAATGGCAGACTCATGGTTTTTTAAGTTAACCAGAGGTGATCTCGACGCTGG...

Protein

Download Protein FASTA

169 aa · TkA04G019440|TK1151|PROTEIN

MTWISPLNSFGAKELHSIETVFNTHPHGCLLILSNTMDSNKGREILKPFTEKGFRVTAISPDLHYLFKNTMADSWFFKLTRGDLDAGFIPFGQNLSNLLRLCLLHKFGGVYMDTDVMILKSFSKLRNSIGAQTLDLGSKNWSRLNNAVMVFDKMHPLVYKFIEEFEKFI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G019440`
TK1151 ID	TkA04G019440
OH-1004 ID	LXL04_010212
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.200
Protein coverage (%)	TK1151 97.041 / OH-1004 36.044 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G019440

Location Chr04:4851806-4852315 (-)

Description Similar to At4g19900: Uncharacterized protein At4g19900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19900`	Uncharacterized protein At4g19900.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010212 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001576 globoside biosynthetic process Biological Process

GO:0006688 glycosphingolipid biosynthetic process Biological Process

GO:0007009 plasma membrane organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0008378 galactosyltransferase activity Molecular Function

GO:0015643 toxic substance binding Molecular Function

GO:0050512 lactosylceramide 4-alpha-galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G19900

hsa:53947

mmu:239559

rno:63888

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.346

Rank 1 · TkA04G019440 · TK1151

Lysosome / Vacuole0.212

Rank 2 · TkA04G019440 · TK1151

Endoplasmic reticulum0.194

Rank 3 · TkA04G019440 · TK1151

Cytoplasm0.113

Rank 4 · TkA04G019440 · TK1151

Extracellular0.103

Rank 5 · TkA04G019440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04488Gly_transf_sug14-133 aa

PF05704Caps_synth93-125 aa

PF12919TcdA_TcdB96-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G019440	`PF04488`	Gly_transf_sug	14	133	1.9e-18	67.7
TkA04G019440	`PF05704`	Caps_synth	93	125	0.00023	21.3
TkA04G019440	`PF12919`	TcdA_TcdB	96	142	0.033	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C8Q4`	Arabidopsis thaliana	sp\|P0C8Q4\|Y4990_ARATH Uncharacterized protein At4g19900	31.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card