TkA04G019030 | RubberDandelionOmics

Gene overview

TkA04G019030

Reference: TK1151 Chr: Chr04 Coordinates: 4772537-4772857 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

321 bp · TkA04G019030|TK1151|cDNA

ATGGGGAAGTATGCGGCGGAGATTCGTGATCCTAATAAGCAAGGCGTTAGGGTGTGGCTTGGGACTTTTACCACGGCGGAGGAAGCTGCACGAGCTTATGATCGGGCGGCGTTTGATATGAGAGGTCATATGGCGGTTCTGAACTTTCCGGCGGAATACCCTCCGACCTTTTCTGCTGCTGCTTATACTGCTTCCATGGCGGCAGCTGCATCTTCGTCGTCGTCTTCCATGGCTACACGAGAAGTATTTGAATTTGAATG...

CDS

Download CDS FASTA

321 bp · TkA04G019030|TK1151|CDS

ATGGGGAAGTATGCGGCGGAGATTCGTGATCCTAATAAGCAAGGCGTTAGGGTGTGGCTTGGGACTTTTACCACGGCGGAGGAAGCTGCACGAGCTTATGATCGGGCGGCGTTTGATATGAGAGGTCATATGGCGGTTCTGAACTTTCCGGCGGAATACCCTCCGACCTTTTCTGCTGCTGCTTATACTGCTTCCATGGCGGCAGCTGCATCTTCGTCGTCGTCTTCCATGGCTACACGAGAAGTATTTGAATTTGAATG...

Protein

Download Protein FASTA

106 aa · TkA04G019030|TK1151|PROTEIN

MGKYAAEIRDPNKQGVRVWLGTFTTAEEAARAYDRAAFDMRGHMAVLNFPAEYPPTFSAAAYTASMAAAASSSSSSMATREVFEFECLDDKYLEDLLDYDNAKNKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G019030`
TK1151 ID	TkA04G019030
OH-1004 ID	LXL04_036878
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.057 / OH-1004 63.636 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G019030

Location Chr04:4772537-4772857 (+)

Description Similar to ERF098: Ethylene-responsive transcription factor ERF098

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23230`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g23220`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g43410`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g04370`	Acts as a transcriptional activator.	No verified direct reference in this release
`At5g51190`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036878 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0010186 positive regulation of cellular defense response Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0070482 response to oxygen levels Biological Process

GO:0090332 stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G23230

ath:AT5G43410

ath:AT5G51190

sly:544042

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.764

Rank 1 · TkA04G019030 · TK1151

Cytoplasm0.240

Rank 2 · TkA04G019030 · TK1151

Endoplasmic reticulum0.060

Rank 3 · TkA04G019030 · TK1151

Cell membrane0.057

Rank 4 · TkA04G019030 · TK1151

Plastid0.039

Rank 5 · TkA04G019030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP22-43 aa

PF04984Phage_sheath_14-81 aa

PF00847AP259-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G019030	`PF00847`	AP2	2	43	6.1e-09	36.8
TkA04G019030	`PF04984`	Phage_sheath_1	4	81	0.017	15.7
TkA04G019030	`PF00847`	AP2	59	67	6.1e-09	36.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTC5`	Arabidopsis thaliana	sp\|Q9LTC5\|ERF98_ARATH Ethylene-responsive transcription factor ERF098	60.000%	Swiss-Prot	High
`Q9LTC6`	Arabidopsis thaliana	sp\|Q9LTC6\|ERF95_ARATH Ethylene-responsive transcription factor ERF095	62.400%	Swiss-Prot	High
`Q9LSX0`	Arabidopsis thaliana	sp\|Q9LSX0\|ERF96_ARATH Ethylene-responsive transcription factor ERF096	61.500%	Swiss-Prot	High
`P93822`	Arabidopsis thaliana	sp\|P93822\|ERF97_ARATH Ethylene-responsive transcription factor 14	53.800%	Swiss-Prot	High
`Q8VY90`	Arabidopsis thaliana	sp\|Q8VY90\|EF105_ARATH Ethylene-responsive transcription factor ERF105	78.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card