TkA04G018880 | RubberDandelionOmics

Gene overview

TkA04G018880

Reference: TK1151 Chr: Chr04 Coordinates: 4735469-4736261 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · TkA04G018880|TK1151|cDNA

ATGCCACCCGAAAGAAGACCCGGCGATTTTGTCACCGTTTGCGAGGAAATTCTGGTGATTGATCTTCAAAACAATCGGTCTGAGACCGTCCAACAAATTCTAAAAGCTTGTCAAGAATTCGGCTTATTTCAGGTGATCAATCATGGAGTTTCCGAGAAGATGATGGCAGATATTAGGGTTTTGTACGATGAGTTCTTTAACATGCCGATTGAGGACAAGTTAGGTCTTTACGCGAAGACTTATGGTAAGGGGTGTACGCT...

CDS

Download CDS FASTA

651 bp · TkA04G018880|TK1151|CDS

ATGCCACCCGAAAGAAGACCCGGCGATTTTGTCACCGTTTGCGAGGAAATTCTGGTGATTGATCTTCAAAACAATCGGTCTGAGACCGTCCAACAAATTCTAAAAGCTTGTCAAGAATTCGGCTTATTTCAGGTGATCAATCATGGAGTTTCCGAGAAGATGATGGCAGATATTAGGGTTTTGTACGATGAGTTCTTTAACATGCCGATTGAGGACAAGTTAGGTCTTTACGCGAAGACTTATGGTAAGGGGTGTACGCT...

Protein

Download Protein FASTA

216 aa · TkA04G018880|TK1151|PROTEIN

MPPERRPGDFVTVCEEILVIDLQNNRSETVQQILKACQEFGLFQVINHGVSEKMMADIRVLYDEFFNMPIEDKLGLYAKTYGKGCTLHTSGVNYAKEKVHFWKDTLKHDCHPLEEHNLSWPDKPARYREEVGRCVIEVRKMGFKILNLIGEALGLNEGYFDRVSQEQYMAVHLYPQCPDPSLAMGIDDHADPNIITFLQQDQYGLQIQKRWEMDGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G018880`
TK1151 ID	TkA04G018880
OH-1004 ID	LXL04_036881
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G018880`
Location	Chr04:4735469-4736261 (+)
Description	No functional description available
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036881` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002229 defense response to oomycetes Biological Process GO:0002238 response to molecule of fungal origin Biological Process GO:0002239 response to oomycetes Biological Process GO:0009617 response to bacterium Biological Process GO:0009620 response to fungus Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009805 coumarin biosynthetic process Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0010150 leaf senescence Biological Process GO:0042742 defense response to bacterium Biological Process GO:0046244 salicylic acid catabolic process Biological Process GO:0071456 cellular response to hypoxia Biological Process
KEGG gene cross-reference	ag:BAA05630 ag:BAA78340 ath:AT5G24530 dosa:Os10g0536400 osa:4349238 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.821

Rank 1 · TkA04G018880 · TK1151

Nucleus0.314

Rank 2 · TkA04G018880 · TK1151

Endoplasmic reticulum0.051

Rank 3 · TkA04G018880 · TK1151

Cell membrane0.045

Rank 4 · TkA04G018880 · TK1151

Mitochondrion0.045

Rank 5 · TkA04G018880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N19-120 aa

PF031712OG-FeII_Oxy167-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G018880	`PF14226`	DIOX_N	19	120	2.7e-20	73.9
TkA04G018880	`PF03171`	2OG-FeII_Oxy	167	210	1.5e-07	32.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card