TkA04G018740 | RubberDandelionOmics

Gene overview

TkA04G018740

Reference: TK1151 Chr: Chr04 Coordinates: 4697556-4699693 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1734 bp · TkA04G018740|TK1151|cDNA

GGGGTCAAAAACGTGATTTATAGTTTTATATTTAGCGTAAAAAATAACAAGAGATTTTTGGGACCCATATAAACAAAATCTCAAATTCGGAGGTCCAAAAATATACATAAAGAGTTACAAGCGCCACCCTTCCCGCGTCCACGTTGGCTATTTGGCGCGAAGCTGACTTGTCAATAACACACGCTCAGTTGCCAGATAGGCATTGGCGCCAAAAAAACCCTATTAGTTTGCAGTCGTTCTCTTTCATTTGTATCTTTACA...

CDS

Download CDS FASTA

609 bp · TkA04G018740|TK1151|CDS

ATGCCTCAATCATTCAAGCGACGATTCTCAAAACAAGTTCCTGACCATCTTTCACCACAAGTTTCTGAACATACCTCCATTAAAGTAGACTGTGTAACTATTCCTCCATCTCCAGTTAAAGTAACTTCAAAGCTATTTGAAACCCCAATCAAGAGCTTTTCAAAGAAACGAGATCTTTCTTCCATTGATGAAACTCCATCCAAGCTTATTTCTACTCCAATCAGTGCTACACCTGCACAATCATCTAGGAGGCCAGTAAG...

Protein

Download Protein FASTA

202 aa · TkA04G018740|TK1151|PROTEIN

MPQSFKRRFSKQVPDHLSPQVSEHTSIKVDCVTIPPSPVKVTSKLFETPIKSFSKKRDLSSIDETPSKLISTPISATPAQSSRRPVRGFMTPDEDPVTSPTKSTPKKLTKRQVRGSLMYDDDIFSGDLLASIKEKEQKAIEGNDPAISQAKFRKQMISGLPKLFDSLIFIFLKRSVFTKEELIHTIISCRLDIVDRSKSYLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G018740`
TK1151 ID	TkA04G018740
OH-1004 ID	LXL04_035619
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.100
Protein coverage (%)	TK1151 97.030 / OH-1004 23.069 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G018740`
Location	Chr04:4697556-4699693 (-)
Description	Similar to CDT1A: CDT1-like protein a, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035619` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000076 DNA replication checkpoint signaling Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0006260 DNA replication Biological Process GO:0009658 chloroplast organization Biological Process GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process GO:0048229 gametophyte development Biological Process GO:0051276 chromosome organization Biological Process GO:0071163 DNA replication preinitiation complex assembly Biological Process GO:0005634 nucleus Cellular Component GO:0009507 chloroplast Cellular Component GO:0003677 DNA binding Molecular Function GO:0004693 cyclin-dependent protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference	ath:AT2G31270 ath:AT3G54710 hsa:79830 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.887

Rank 1 · TkA04G018740 · TK1151

Cytoplasm0.254

Rank 2 · TkA04G018740 · TK1151

Mitochondrion0.024

Rank 3 · TkA04G018740 · TK1151

Cell membrane0.016

Rank 4 · TkA04G018740 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA04G018740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16679CDT1_C127-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G018740	`PF16679`	CDT1_C	127	196	1.3e-09	39.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card