TkA04G018490 | RubberDandelionOmics

Gene overview

TkA04G018490

Reference: TK1151 Chr: Chr04 Coordinates: 4643583-4644503 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · TkA04G018490|TK1151|cDNA

ATGAATAAATTAGTTAGTGAGGTAGATACCACTGAACTAAAACGAAAGGCAGTGGAGAAGAAAGCAGAACAAGGGCTTAAAGTTGTTAGAGTTGTCGCTGTTCTTGGAGGACTTCTTCAAAGTTTTCTATTTATGTGCATATGTGGCATTACAGCCTCTTTATGTGGCGGTAAACCTTCTGAGGGGGTTTTTGATGGTGTGCTTCTTTCAATGTCTTCAACAGTTGTGGTTTTGAAGTTTTTGATGGAAAAGAATAGTGT...

CDS

Download CDS FASTA

393 bp · TkA04G018490|TK1151|CDS

ATGAATAAATTAGTTAGTGAGGTAGATACCACTGAACTAAAACGAAAGGCAGTGGAGAAGAAAGCAGAACAAGGGCTTAAAGTTGTTAGAGTTGTCGCTGTTCTTGGAGGACTTCTTCAAAGTTTTCTATTTATGTGCATATGTGGCATTACAGCCTCTTTATGTGGCGGTAAACCTTCTGAGGGGGTTTTTGATGGTGTGCTTCTTTCAATGTCTTCAACAGTTGTGGTTTTGAAGTTTTTGATGGAAAAGAATAGTGT...

Protein

Download Protein FASTA

130 aa · TkA04G018490|TK1151|PROTEIN

MNKLVSEVDTTELKRKAVEKKAEQGLKVVRVVAVLGGLLQSFLFMCICGITASLCGGKPSEGVFDGVLLSMSSTVVVLKFLMEKNSVNVFHGQVTIGTLILQILTDCTVGLLFALLPVLGGTSGVLSHSR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G018490`
TK1151 ID	TkA04G018490
OH-1004 ID	LXL04_006472
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.000
Protein coverage (%)	TK1151 80.769 / OH-1004 72.414 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G018490

Location Chr04:4643583-4644503 (+)

Description Similar to KEA4: K(+) efflux antiporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19600`	May act as an electroneutral K⁺/H⁺ antiporter in K⁺ homeostasis and osmotic adjustment.	A novel AtKEA gene family, homolog of bacterial K+/H+ antiporters, plays potential roles in K+ homeostasis and osmotic adjustment in Arabidopsis.2013 · DOI: 10.1371/journal.pone.0081463 Golgi-localized cation/proton exchangers regulate ionic homeostasis and skotomorphogenesis in Arabidopsis.2019 · DOI: 10.1111/pce.13452 K + Efflux Antiporters 4, 5, and 6 Mediate pH and K + Homeostasis in Endomembrane Compartments.2018 · DOI: 10.1104/pp.18.01053 Evidence for potassium transport activity of Arabidopsis KEA1-KEA6.2019 · DOI: 10.1038/s41598-019-46463-7
`At5g11800`	May act as an electroneutral K⁺/H⁺ antiporter in K⁺ homeostasis and osmotic adjustment.	Golgi-localized cation/proton exchangers regulate ionic homeostasis and skotomorphogenesis in Arabidopsis.2019 · DOI: 10.1111/pce.13452 K + Efflux Antiporters 4, 5, and 6 Mediate pH and K + Homeostasis in Endomembrane Compartments.2018 · DOI: 10.1104/pp.18.01053 Evidence for potassium transport activity of Arabidopsis KEA1-KEA6.2019 · DOI: 10.1038/s41598-019-46463-7
`At5g51710`	May act as an electroneutral K⁺/H⁺ antiporter in K⁺ homeostasis and osmotic adjustment.	A novel AtKEA gene family, homolog of bacterial K+/H+ antiporters, plays potential roles in K+ homeostasis and osmotic adjustment in Arabidopsis.2013 · DOI: 10.1371/journal.pone.0081463 Golgi-localized cation/proton exchangers regulate ionic homeostasis and skotomorphogenesis in Arabidopsis.2019 · DOI: 10.1111/pce.13452 K + Efflux Antiporters 4, 5, and 6 Mediate pH and K + Homeostasis in Endomembrane Compartments.2018 · DOI: 10.1104/pp.18.01053 Evidence for potassium transport activity of Arabidopsis KEA1-KEA6.2019 · DOI: 10.1038/s41598-019-46463-7

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006472 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015386 potassium:proton antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G19600

ath:AT5G11800

ath:AT5G51710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.424

Rank 1 · TkA04G018490 · TK1151

Cell membrane0.243

Rank 2 · TkA04G018490 · TK1151

Lysosome / Vacuole0.163

Rank 3 · TkA04G018490 · TK1151

Golgi apparatus0.154

Rank 4 · TkA04G018490 · TK1151

Cytoplasm0.123

Rank 5 · TkA04G018490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00999Na_H_Exchanger26-121 aa

PF29119F13C5_C41-57 aa

PF29119F13C5_C107-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G018490	`PF00999`	Na_H_Exchanger	26	121	1.6e-12	47.7
TkA04G018490	`PF29119`	F13C5_C	41	57	0.11	13.0
TkA04G018490	`PF29119`	F13C5_C	107	120	0.11	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUN3`	Arabidopsis thaliana	sp\|Q9ZUN3\|KEA4_ARATH K(+) efflux antiporter 4	75.200%	Swiss-Prot	High
`B5X0N6`	Arabidopsis thaliana	sp\|B5X0N6\|KEA6_ARATH K(+) efflux antiporter 6	77.200%	Swiss-Prot	High
`Q8VYR9`	Arabidopsis thaliana	sp\|Q8VYR9\|KEA5_ARATH K(+) efflux antiporter 5	68.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card