Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2054 bp · TkA04G017120|TK1151|cDNA
TAAAGGGGGTGTTTGACTGATATGAATATCTTTTTGGTCCGGTCAAAACATCTGGTCTGGTCACCCCTATTTACCACCCATAATTCTATTACGAACCCTAACCTATAAATACCACGAAATTGAATTCGATCATCTTTTTTTCTCGATTTGTATGAAACGGAAGTCACAATCATTCGATTCTCTCTTGTTTATGAACCGGCATTTTCAAATATACTGCGAGTGAAACGCTTCAGATTTGAAGATTTGAATTTTGAACAGAT...
1626 bp · TkA04G017120|TK1151|CDS
ATGGATGCACATTCATCTCACTTGACGGCACCACTCCGATCGCGTAGCTCACAGACTCCGTCACCATCGCACTCGGCCTCGGCCTCCGCAACTTCTTCATTTCGCAAGCGGAAGTTTAACGCGCCGGAAGACCACGCGCCTCCTTTCCCTTCGCCATTCTCCGATACTCGCGATGGCGCGCTTACCTCCACTGACGATCTCGAGAGCATCAGTGCTCGTGGCGGTGCTGATTCCTACGATTCTGAAGAATTCGAGGGCGT...
Protein
Download Protein FASTA541 aa · TkA04G017120|TK1151|PROTEIN
MDAHSSHLTAPLRSRSSQTPSPSHSASASATSSFRKRKFNAPEDHAPPFPSPFSDTRDGALTSTDDLESISARGGADSYDSEEFEGVVDDEAEEYDDISMRNFTASRLENNFGPVGRNTKLKMDNRVKVEPSEVGKDGGPGAAGSTPAAVPGIAIKEETVKSIFTENLQTSGAYCAREESLKKEEEAGKLKFVCVSNDNIDEHMIWLIGLKNIFSRQLPNMPKEYIVRLVMDRGHKSVMVIRCNTVVGGITYRPYISQKF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G017120 |
|---|---|
| TK1151 ID | TkA04G017120 |
| OH-1004 ID | LXL04_036926 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 86.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G017120 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:4253723-4257340 (-) | ||||||||||||
| Description | Similar to HAG1: Histone acetyltransferase GCN5 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006325 chromatin organization Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009416 response to light stimulus Biological Process GO:0009908 flower development Biological Process GO:0010015 root morphogenesis Biological Process GO:0010321 regulation of vegetative phase change Biological Process GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0140673 transcription elongation-coupled chromatin remodeling Biological Process | ||||||||||||
| KEGG gene cross-reference | ago:AGOS_AER297C ath:AT3G54610 dosa:Os10g0415900 kla:KLLA0_A05115g sce:YGR252W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00439Bromodomain80-98 aaPF13673Acetyltransf_10233-317 aaPF00583Acetyltransf_1234-315 aaPF13508Acetyltransf_7238-316 aaPF08445FR47256-326 aaPF00439Bromodomain437-516 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G017120 | PF00439 | Bromodomain | 80 | 98 | 6.8e-20 | 71.6 |
| TkA04G017120 | PF13673 | Acetyltransf_10 | 233 | 317 | 2.6e-06 | 28.2 |
| TkA04G017120 | PF00583 | Acetyltransf_1 | 234 | 315 | 4.3e-12 | 47.0 |
| TkA04G017120 | PF13508 | Acetyltransf_7 | 238 | 316 | 4.9e-07 | 30.8 |
| TkA04G017120 | PF08445 | FR47 | 256 | 326 | 0.028 | 15.1 |
| TkA04G017120 | PF00439 | Bromodomain | 437 | 516 | 6.8e-20 | 71.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.