TkA04G016310 | RubberDandelionOmics

Gene overview

TkA04G016310

Reference: TK1151 Chr: Chr04 Coordinates: 4063659-4065092 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

743 bp · TkA04G016310|TK1151|cDNA

CTTCTCTCTCACTTTATATTTGTCTAATCACGGTTTCACCTAACAAAAAGCTATAATTTGTCGGAGATGGCCGAAAGACTGACATATGATCAAATCAGCGAGTTTCGTCAGGCTTTTTCAATGATCGATAAGAATTCTGATGGGTTGATAAGCACTGATGATTTGATCGGTGTAATTAAAACCTTGAATGAAAACGCAACTAACGAAGATGTTCAAGAGATGATGAACGAAGTTGATGGAAACGAAGATGGCACTATTGA...

CDS

Download CDS FASTA

450 bp · TkA04G016310|TK1151|CDS

ATGGCCGAAAGACTGACATATGATCAAATCAGCGAGTTTCGTCAGGCTTTTTCAATGATCGATAAGAATTCTGATGGGTTGATAAGCACTGATGATTTGATCGGTGTAATTAAAACCTTGAATGAAAACGCAACTAACGAAGATGTTCAAGAGATGATGAACGAAGTTGATGGAAACGAAGATGGCACTATTGATTTCGATGAATTTCTTACTATCATGTCCAAGAGGATGAAAGAAAGTGTGAGCGACGAGCTAAAAGA...

Protein

Download Protein FASTA

149 aa · TkA04G016310|TK1151|PROTEIN

MAERLTYDQISEFRQAFSMIDKNSDGLISTDDLIGVIKTLNENATNEDVQEMMNEVDGNEDGTIDFDEFLTIMSKRMKESVSDELKEAFKVFDRDQDGYISPEELRNVMINLGERLKDEELKQMMREADLDGDGVISYEEFVRVMMHSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G016310`
TK1151 ID	TkA04G016310
OH-1004 ID	LXL04_036938
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 36.913 / OH-1004 36.913 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G016310`
Location	Chr04:4063659-4065092 (-)
Description	Similar to CAM4: Calmodulin-4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036938` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005513 detection of calcium ion Biological Process GO:0009612 response to mechanical stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009536 plastid Cellular Component GO:0016460 myosin II complex Cellular Component GO:0005509 calcium ion binding Molecular Function GO:0030234 enzyme regulator activity Molecular Function
KEGG gene cross-reference	ath:AT1G66410 ath:AT5G37780 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.644

Rank 1 · TkA04G016310 · TK1151

Nucleus0.314

Rank 2 · TkA04G016310 · TK1151

Cell membrane0.093

Rank 3 · TkA04G016310 · TK1151

Lysosome / Vacuole0.087

Rank 4 · TkA04G016310 · TK1151

Endoplasmic reticulum0.067

Rank 5 · TkA04G016310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30272Mei-P22_C2-13 aa

PF25578EF-hand_STIM15-33 aa

PF21008AIF-18-74 aa

PF12763EH9-73 aa

PF25825SAPC2_N10-77 aa

PF23564EF-hand_FSTL111-77 aa

PF20742DUF5580_M11-80 aa

PF00036EF-hand_112-40 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G016310	`PF30272`	Mei-P22_C	2	13	0.15	12.6
TkA04G016310	`PF25578`	EF-hand_STIM1	5	33	0.015	16.1
TkA04G016310	`PF21008`	AIF-1	8	74	1e-11	46.0
TkA04G016310	`PF12763`	EH	9	73	1.8e-09	38.2
TkA04G016310	`PF25825`	SAPC2_N	10	77	9.4e-06	26.1
TkA04G016310	`PF23564`	EF-hand_FSTL1	11	77	2.3e-11	44.9
TkA04G016310	`PF20742`	DUF5580_M	11	80	0.0016	19.2
TkA04G016310	`PF00036`	EF-hand_1	12	40	2.3e-37	124.5
TkA04G016310	`PF13499`	EF-hand_7	12	74	1.1e-34	119.3
TkA04G016310	`PF13405`	EF-hand_6	12	40	6.9e-29	97.5
TkA04G016310	`PF13833`	EF-hand_8	12	36	4.1e-23	81.6
TkA04G016310	`PF25325`	EF-hand_EFHB_C	13	41	0.00012	22.6
TkA04G016310	`PF05042`	Caleosin	13	40	0.0012	19.5
TkA04G016310	`PF13202`	EF-hand_5	14	33	3.6e-28	96.4
TkA04G016310	`PF30551`	CFAP251_C	14	126	1e-08	35.8
TkA04G016310	`PF24548`	EF_EFCAB10_C	14	77	3e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card