RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G015910
Reference: TK1151 Chr: Chr04 Coordinates: 3970735-3973728 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2958 bp · TkA04G015910|TK1151|cDNA

ATGCTTTACAACAGAACCACAAACAACCTCACCGTCGCTAAAAAAAGATGGCGTCGTGCATACTTCACCATCTATTTCTCCAACACCATGGTCTCCATCGCAAAAAATAATGTCTACAGAACACAAACCGTTTCCGAAATCATATCAATCCCTTCATACTCGGCCTGTATCAACAACACTGTGTCGGATATCGATCCGACACAGCTGACTGATATAGTCCAAAACAAGTATTTAAAAAGCCTCAACAAGTTCGGCGGCAT...

CDS

Download CDS FASTA

2958 bp · TkA04G015910|TK1151|CDS

ATGCTTTACAACAGAACCACAAACAACCTCACCGTCGCTAAAAAAAGATGGCGTCGTGCATACTTCACCATCTATTTCTCCAACACCATGGTCTCCATCGCAAAAAATAATGTCTACAGAACACAAACCGTTTCCGAAATCATATCAATCCCTTCATACTCGGCCTGTATCAACAACACTGTGTCGGATATCGATCCGACACAGCTGACTGATATAGTCCAAAACAAGTATTTAAAAAGCCTCAACAAGTTCGGCGGCAT...

Protein

Download Protein FASTA

985 aa · TkA04G015910|TK1151|PROTEIN

MLYNRTTNNLTVAKKRWRRAYFTIYFSNTMVSIAKNNVYRTQTVSEIISIPSYSACINNTVSDIDPTQLTDIVQNKYLKSLNKFGGIDGLADALNTNLESGVNSRDLDSIRTVFGSNTYTKQPPKGLLYFVVEAFKDITILILMGCAALSLGFGIKEHGIGEGWYEGGSIFLAVFLVIVVSAISNFRQEKQFHNLSKISDNIKIDVIREGRRQKISIFDIVVGDIVILNIGDQIPADGLFIDGHSTLIDESSMTGESEPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G015910
TK1151 IDTkA04G015910
OH-1004 IDLXL04_036939
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.800
Protein coverage (%)TK1151 100.000 / OH-1004 98.811
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G015910
LocationChr04:3970735-3973728 (-)
DescriptionSimilar to ACA12: Calcium-transporting ATPase 12, plasma membrane-type
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g63380 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles. No verified direct reference in this release
At3g22910 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles. No verified direct reference in this release
At5g57110 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell. No verified direct reference in this release
At4g29900 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the endoplasmic reticulum. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os10g0418100 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles (By similarity).
Genome-wide expressional and functional analysis of calcium transport elements during abiotic stress and development in rice.2014 · DOI: 10.1111/febs.12656
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036939 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009624 response to nematode Biological Process
GO:0051480 regulation of cytosolic calcium ion concentration Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009536 plastid Cellular Component
GO:0005388 P-type calcium transporter activity Molecular Function
GO:0005516 calmodulin binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0016887 ATP hydrolysis activity Molecular Function
GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference
ath:AT3G22910
ath:AT3G63380
ath:AT4G29900
ath:AT5G57110
dosa:Os10g0418100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.468
Rank 1 · TkA04G015910 · TK1151
Lysosome / Vacuole0.198
Rank 2 · TkA04G015910 · TK1151
Endoplasmic reticulum0.174
Rank 3 · TkA04G015910 · TK1151
Cytoplasm0.122
Rank 4 · TkA04G015910 · TK1151
Golgi apparatus0.105
Rank 5 · TkA04G015910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00690Cation_ATPase_N85-150 aa
PF31039DUF8779125-200 aa
PF14927Neurensin139-158 aa
PF00689Cation_ATPase_C146-190 aa
PF14927Neurensin168-190 aa
PF00122E1-E2_ATPase204-301 aa
PF14927Neurensin295-339 aa
PF18895T4SS_pilin311-350 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G015910PF00690Cation_ATPase_N851503.2e-1143.4
TkA04G015910PF31039DUF87791252000.1312.8
TkA04G015910PF14927Neurensin1391580.1812.2
TkA04G015910PF00689Cation_ATPase_C1461902.9e-45154.9
TkA04G015910PF14927Neurensin1681900.1812.2
TkA04G015910PF00122E1-E2_ATPase2043011.1e-2280.4
TkA04G015910PF14927Neurensin2953390.1812.2
TkA04G015910PF18895T4SS_pilin3113500.01616.1
TkA04G015910PF00689Cation_ATPase_C3203492.9e-45154.9
TkA04G015910PF31039DUF87793323480.1312.8
TkA04G015910PF18895T4SS_pilin3623820.01616.1
TkA04G015910PF00702Hydrolase4244478.9e-1659.6
TkA04G015910PF13246Cation_ATPase4636221.1e-2591.2
TkA04G015910PF00702Hydrolase6007338.9e-1659.6
TkA04G015910PF12710HAD6207300.01416.5
TkA04G015910PF08282Hydrolase_36256570.006417.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LY77Arabidopsis thalianasp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type66.400%Swiss-ProtHigh
Q9LIK7Arabidopsis thalianasp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type65.300%Swiss-ProtHigh
Q9LF79Arabidopsis thalianasp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type56.000%Swiss-ProtHigh
Q9SZR1Arabidopsis thalianasp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type55.800%Swiss-ProtHigh
Q7XEK4Oryza sativa subsp. japonicasp|Q7XEK4|ACA7_ORYSJ Calcium-transporting ATPase 7, plasma membrane-type58.000%Swiss-ProtHigh

JBrowse

View in Genome Browser