TkA04G014840 | RubberDandelionOmics

Gene overview

TkA04G014840

Reference: TK1151 Chr: Chr04 Coordinates: 3719232-3721065 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1355 bp · TkA04G014840|TK1151|cDNA

AAGAAGTTTCTCAATTTCTCCAGGAAAACAACTGCTTGTCACCTTTACAATAACTCCTTCCCAAAACCCTTATATAGTTATATTTCTTCATCGTTAAGTTCAGAATTTGTTCAAATACCATTCCGATTTCCTAATTCCTAACCCTAATTTCTCAAAATTTGAATCAAGTAGCCGGAAGTGTGTACTCGCTCTATGATGTTTAGCCAACCGCCATTTGGGAAGACCGACTTGGAGTCGGGAACAAGCGGTGGAACGCTGTA...

CDS

Download CDS FASTA

738 bp · TkA04G014840|TK1151|CDS

ATGATGTTTAGCCAACCGCCATTTGGGAAGACCGACTTGGAGTCGGGAACAAGCGGTGGAACGCTGTATCCAACTATGTTGGAGTCGCCGGAACTCCGGTGGTCTTTCATACGAAAGGTATATTCTATCGTTGCTATTCAGCTACTGCTAACCGTCGCTGTTGGCGCCGTCGTTGTCTCTTATCGCCCAATTGCTACTTTCATGACAACTACCGGCGGTGGATTGGCTTGTTATATTCTTCTCATCATCACGCCATTCAT...

Protein

Download Protein FASTA

245 aa · TkA04G014840|TK1151|PROTEIN

MMFSQPPFGKTDLESGTSGGTLYPTMLESPELRWSFIRKVYSIVAIQLLLTVAVGAVVVSYRPIATFMTTTGGGLACYILLIITPFITLCPLYYYHQRHPVNYVLLSIFTISLAFAIGLTCAFTSGKVILEAAILTAVVVVSLTLFTFWAAKRGYDFNFLGPFLFGAIMVLMVFSLIQIFFPLGRISVMIYGCLAAIVFCGYIVYDTDNLIKRYTYDEYIWASISLYLDIINLFLSLLTIFRAAE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G014840`
TK1151 ID	TkA04G014840
OH-1004 ID	LXL04_036944
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G014840

Location Chr04:3719232-3721065 (-)

Description Similar to LFG4: Protein LIFEGUARD 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03070`	Protein LIFEGUARD 4.	No verified direct reference in this release
`At3g63310`	Regulates the brassinosteroid (BR) signaling pathway that mediates cell elongation and organ morphogenesis.	LIFEGUARD proteins support plant colonization by biotrophic powdery mildew fungi.2013 · DOI: 10.1093/jxb/ert217
`At4g02690`	Protein LIFEGUARD 3.	No verified direct reference in this release
`At4g14730`	(Microbial infection) Facilitates the development of the powdery mildew fungus E.cruciferarum.	LIFEGUARD proteins support plant colonization by biotrophic powdery mildew fungi.2013 · DOI: 10.1093/jxb/ert217
`At4g15470`	BI1-like protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036944 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0034620 cellular response to unfolded protein Biological Process

GO:1905421 regulation of plant organ morphogenesis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0005262 calcium channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G03070

ath:AT3G63310

ath:AT4G02690

ath:AT4G14730

ath:AT4G15470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.334

Rank 1 · TkA04G014840 · TK1151

Cytoplasm0.297

Rank 2 · TkA04G014840 · TK1151

Golgi apparatus0.277

Rank 3 · TkA04G014840 · TK1151

Endoplasmic reticulum0.169

Rank 4 · TkA04G014840 · TK1151

Cell membrane0.161

Rank 5 · TkA04G014840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15817TMEM409-81 aa

PF01027Bax1-I33-243 aa

PF09843DUF207043-205 aa

PF26236DUF8054_N45-71 aa

PF11970GPR_Gpa2_C77-116 aa

PF26236DUF8054_N128-143 aa

PF11970GPR_Gpa2_C144-157 aa

PF15817TMEM40169-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G014840	`PF15817`	TMEM40	9	81	0.14	12.6
TkA04G014840	`PF01027`	Bax1-I	33	243	1.3e-51	176.1
TkA04G014840	`PF09843`	DUF2070	43	205	2.4	7.1
TkA04G014840	`PF26236`	DUF8054_N	45	71	0.015	15.9
TkA04G014840	`PF11970`	GPR_Gpa2_C	77	116	1.8	9.4
TkA04G014840	`PF26236`	DUF8054_N	128	143	0.015	15.9
TkA04G014840	`PF11970`	GPR_Gpa2_C	144	157	1.8	9.4
TkA04G014840	`PF15817`	TMEM40	169	183	0.14	12.6
TkA04G014840	`PF26236`	DUF8054_N	175	218	0.015	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA63`	Arabidopsis thaliana	sp\|Q9SA63\|LFG4_ARATH Protein LIFEGUARD 4	79.300%	Swiss-Prot	High
`Q9M1V9`	Arabidopsis thaliana	sp\|Q9M1V9\|LFG2_ARATH Protein LIFEGUARD 2	75.800%	Swiss-Prot	High
`Q9ZQX7`	Arabidopsis thaliana	sp\|Q9ZQX7\|LFG3_ARATH Protein LIFEGUARD 3	73.400%	Swiss-Prot	High
`F4JIE8`	Arabidopsis thaliana	sp\|F4JIE8\|LFG1_ARATH Protein LIFEGUARD 1	56.700%	Swiss-Prot	High
`Q94A20`	Arabidopsis thaliana	sp\|Q94A20\|LFG5_ARATH BI1-like protein	56.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card